KEGG   Theileria parva: TP01_0262Help
Entry
TP01_0262         CDS       T00254                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tpv  Theileria parva
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tpv00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TP01_0262
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TP01_0262
  Amino acid metabolism
   00310 Lysine degradation
    TP01_0262
Enzymes [BR:tpv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     TP01_0262
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 456 aa AA seqDB search
MAHNIRFCLRFHRYLNSFARNKKFSRFYSVLPTCKSAFTDPSTRYTNCFVLSKSSDFNPL
KLIGNRYFSKDLKVINVPTLGDSISEGTLTKWAVSVGDYLNVDDLIAVVETDKVSVDVNS
PFSGVLTKTFSNTGDTILVGKPLVEIDLAGKPSDKPPEKKTEDKPPTPAPSKPEPKSPEP
PKPSDSKPVSSSQVKPPTPVQSKPLPPLEKASSLSMVPPTQVPSSDLEPETRVPLTRMRM
RIAERLKHAQTENVMLTTFNECDMSELTKVRKMLNESGEVSCKLGFVSAFMRASTLALLK
MPIMNSYIEGNEMVTKNYVDISVAVATPTGLLVPVIRNCEFKNWEELELSLLEMAKKARE
GSITIEDMTGGTFTISNGGVYGSLLSTPIINPPQSSILGMHAITKRPVVRDDNIVIRPVM
NVALTYDHRLIDGRDAVTFLNTIKKFIENPSLLLLK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggcacataatattagattctgtcttcgttttcatagataccttaacagttttgccaga
aataaaaaattttctagattctattctgtccttccaacctgtaaatccgcctttacagac
cctagtacgagatataccaattgttttgttttatcaaaaagttctgattttaatcctttg
aagcttatcggcaatcgttacttttcaaaagatctaaaggttattaatgttcctactctg
ggtgattctattagtgagggtaccctgaccaagtgggccgtttcagttggagattactta
aacgttgatgatctaatagctgttgtggagaccgataaggtctcagtcgatgttaactct
ccattttctggagttctaaccaagactttttcgaatacgggagatacaatcctggttgga
aagccacttgtcgaaattgatttggctggcaaaccttctgacaaaccgccagaaaagaaa
actgaagataaaccacctactcctgctcctagtaaacctgaaccaaagtctcctgaaccc
cctaaaccgtcagattcaaagccagtatcttcttctcaagtcaaaccacccactcctgta
caatctaaaccactaccaccacttgaaaaggcttcttctttgagtatggttccaccaact
caagtcccatcttctgatttagaacctgaaactagagtccccctgaccaggatgcgtatg
aggattgccgaacgccttaaacatgctcagactgagaatgttatgttaacaacattcaac
gagtgtgacatgagtgagttaacgaaggtcaggaagatgctaaatgagtctggcgaagtt
tcatgcaaacttggattcgtctctgccttcatgcgtgcatcaacacttgcgctcttaaag
atgccaattatgaattcatatattgaggggaatgaaatggttacaaagaactatgtcgac
atttcagtcgctgttgccactcccacgggattattagtcccggtgataagaaactgtgaa
tttaagaattgggaagaacttgaactttcacttctggagatggctaagaaggccagggag
ggctctatcaccatcgaggacatgactggcggcactttcactatctctaacggtggcgtt
tacggcagtctcttgagcactccaataatcaaccctcctcaatcttcgattctagggatg
catgcaattactaaacgtccagttgttcgtgatgacaacatagtaataagacctgttatg
aacgtcgctttgacctatgaccacagacttattgacggcagggacgccgttacttttttg
aacactattaagaagtttatagagaacccatcgcttcttctgcttaagtaa

DBGET integrated database retrieval system