KEGG   Theileria parva: TP01_0262Help
Entry
TP01_0262         CDS       T00254                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tpv  Theileria parva
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tpv01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:tpv00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:tpv00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 456 aa AA seqDB search
MAHNIRFCLRFHRYLNSFARNKKFSRFYSVLPTCKSAFTDPSTRYTNCFVLSKSSDFNPL
KLIGNRYFSKDLKVINVPTLGDSISEGTLTKWAVSVGDYLNVDDLIAVVETDKVSVDVNS
PFSGVLTKTFSNTGDTILVGKPLVEIDLAGKPSDKPPEKKTEDKPPTPAPSKPEPKSPEP
PKPSDSKPVSSSQVKPPTPVQSKPLPPLEKASSLSMVPPTQVPSSDLEPETRVPLTRMRM
RIAERLKHAQTENVMLTTFNECDMSELTKVRKMLNESGEVSCKLGFVSAFMRASTLALLK
MPIMNSYIEGNEMVTKNYVDISVAVATPTGLLVPVIRNCEFKNWEELELSLLEMAKKARE
GSITIEDMTGGTFTISNGGVYGSLLSTPIINPPQSSILGMHAITKRPVVRDDNIVIRPVM
NVALTYDHRLIDGRDAVTFLNTIKKFIENPSLLLLK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggcacataatattagattctgtcttcgttttcatagataccttaacagttttgccaga
aataaaaaattttctagattctattctgtccttccaacctgtaaatccgcctttacagac
cctagtacgagatataccaattgttttgttttatcaaaaagttctgattttaatcctttg
aagcttatcggcaatcgttacttttcaaaagatctaaaggttattaatgttcctactctg
ggtgattctattagtgagggtaccctgaccaagtgggccgtttcagttggagattactta
aacgttgatgatctaatagctgttgtggagaccgataaggtctcagtcgatgttaactct
ccattttctggagttctaaccaagactttttcgaatacgggagatacaatcctggttgga
aagccacttgtcgaaattgatttggctggcaaaccttctgacaaaccgccagaaaagaaa
actgaagataaaccacctactcctgctcctagtaaacctgaaccaaagtctcctgaaccc
cctaaaccgtcagattcaaagccagtatcttcttctcaagtcaaaccacccactcctgta
caatctaaaccactaccaccacttgaaaaggcttcttctttgagtatggttccaccaact
caagtcccatcttctgatttagaacctgaaactagagtccccctgaccaggatgcgtatg
aggattgccgaacgccttaaacatgctcagactgagaatgttatgttaacaacattcaac
gagtgtgacatgagtgagttaacgaaggtcaggaagatgctaaatgagtctggcgaagtt
tcatgcaaacttggattcgtctctgccttcatgcgtgcatcaacacttgcgctcttaaag
atgccaattatgaattcatatattgaggggaatgaaatggttacaaagaactatgtcgac
atttcagtcgctgttgccactcccacgggattattagtcccggtgataagaaactgtgaa
tttaagaattgggaagaacttgaactttcacttctggagatggctaagaaggccagggag
ggctctatcaccatcgaggacatgactggcggcactttcactatctctaacggtggcgtt
tacggcagtctcttgagcactccaataatcaaccctcctcaatcttcgattctagggatg
catgcaattactaaacgtccagttgttcgtgatgacaacatagtaataagacctgttatg
aacgtcgctttgacctatgaccacagacttattgacggcagggacgccgttacttttttg
aacactattaagaagtttatagagaacccatcgcttcttctgcttaagtaa

DBGET integrated database retrieval system