KEGG   Theileria parva: TP01_0316Help
Entry
TP01_0316         CDS       T00254                                 

Definition
ubiquitin carboxyl-terminal hydrolase a
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
tpv  Theileria parva
Brite
Enzymes [BR:tpv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     TP01_0316
Peptidases [BR:tpv01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TP01_0316
Exosome [BR:tpv04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   TP01_0316
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 777 aa AA seqDB search
MSERSIEFDGLCSDLGLLIPDSSTVVHKSECLYSIDTEYSLGGIYVNLLTYQSFGKDLLK
FDPIYPNAIYLNIVKRLIPCQQEPDLNEFNTTDHVSEKKVFEESVEYNVFSPQLGSIPLD
HTFGQLLNLCNSIIGHAGYEFKNNQLTFSNILNVHFTQFYLQFTHSNLALFCLFTYELLD
NLELSNFGRSRSMRGICIRLRIRSGLTMTIYPVKNAMPLLTSGSIFPMDMLVVVGRTITV
AGVRTALRDEDNLVIDPLLEEHLKHFGINIHDLRRTEKTLLELELEDNKNYNWLSDASGA
SLIHLQPKLIGILNLGNNCYLNSVLQMLNNVKELNDFFLQYYQTNLQNKFENVNLFLLQY
AKICTCINTDVFIHKCNQILDQYKNLLSESHETDDSLTQVLTHDCFYINPNLFKFTLVTV
YSVIVTVYIVIVTVYIVIVTVYSVIVTVYIVIVTVYSVIVTLWVLDIMNQIIICEELKLV
NVNHVETHILPFELMDIINSKINSLNSNSTDIDDINDINDIEIDITDCVLGWYGSVLVDY
ISSGKVYKANLYNNLTNAPSYLFVKLNRFYMDKVPKKLLNKVTITGEKLELNLNHLNLKE
FQDYTQPPLERNSGFYEVDESFLNQLLLMGFNEFDIRHLFTHFYTFYTILHIFTHFYTFL
HTIYTIYTFYTIYTFYTIYTFYTIPLNMKLLGFYGNSDKVVSYYEQLKTEQLSDNVRETV
VYDLIGFITHIGSNVNSGHYICHLKKDNEWYAFNDTRITKSTNPPIHHGYIYLFQKS
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagagatcgattgagtttgatgggttgtgtagtgacttgggtttattaattcct
gattctagcactgttgtacacaaatccgaatgcctttacagtattgacactgagtattcc
ttgggaggaatttacgtgaatttgttaacgtatcaatcttttggtaaagacttgctcaaa
ttcgatcccatttaccccaacgccatctacctcaacattgtcaaacgccttatcccatgc
caacaagaacccgaccttaacgaattcaacactaccgaccacgtaagtgagaagaaagtg
tttgaggaaagtgttgagtataatgttttttcacctcagctgggctcaattcccctagat
cacactttcggacaacttctcaacctgtgtaattcgataattggacacgccggatacgaa
tttaaaaataaccaactcacattctccaacatactcaacgtacactttactcagttttat
cttcaatttacacactctaatttggctttattttgcttatttacttatgagttacttgat
aatttggaactgagtaattttggtaggagtcgaagtatgcgcgggatttgtatcaggttg
agaatccgaagcggattgactatgacaatttatcctgtgaaaaatgcaatgccactacta
acctctggctcaatctttccgatggatatgttggttgtggtcggaagaactataacagtg
gcgggtgtcaggacggcactgagggacgaggataatctggtgattgatcctctcctggag
gaacatctgaaacacttcggaatcaacatccatgatttgcgaaggactgagaagacgttg
ttggagcttgagcttgaggataataaaaactacaactggctctcagacgccagtggagct
tcactcatacatctacagcccaagttgattgggatactgaacctgggtaacaactgttac
ctcaacagtgtgttacaaatgctaaacaacgttaaggaactaaacgactttttccttcaa
tactatcaaaccaacctgcaaaataaatttgagaatgtgaatttgttcctcctgcaatac
gctaaaatctgtacatgcattaacaccgacgttttcatacacaaatgcaaccaaattctc
gatcagtacaaaaatttattgagtgaatctcacgaaactgatgacagtttgacccaagtg
ctaacgcatgactgcttttacattaacccaaacctcttcaaattcactctagttactgtt
tactcagttatagttactgtttacatagttatagttactgtttacatagttatagttact
gtttactcagttatagttactgtttacatagttatagttactgtttactcagttatagtt
accctgtgggtactagatattatgaaccaaataataatttgtgaagagctgaagttagtt
aatgtaaatcacgtggagacgcatattttaccctttgaactcatggacattattaactca
aaaattaactccctgaattctaattccaccgacatagatgacataaatgatataaatgac
atagaaattgatatcaccgactgtgtgttgggttggtatggtagtgtgttggtggattat
ataagtagtggcaaggtgtacaaggcgaacttgtataataacttgacaaacgcgccaagt
tacttatttgtcaagttgaaccgcttctacatggacaaagtgcccaaaaagttactcaac
aaagtgacgataaccggggagaaattagaactaaacctgaatcacctgaacttgaaggaa
ttccaagactacacacagccacctctcgaacgcaattcaggattttatgaagtcgacgaa
tcgttcctcaaccaactactactcatgggattcaacgaattcgatatcaggcatcttttt
acacacttttacacattttacacaattttacacatttttacacatttttacacattttta
cacactatttacacaatttacacattttacacaatttacacattttacacaatttacaca
ttttacacaataccactgaacatgaaattacttggattctacggtaactcggataaagtt
gtgagttactatgaacagcttaaaactgagcagctaagtgataatgtgagggagactgta
gtgtatgatctgattgggtttataacgcatatcgggagtaatgtgaattcagggcattat
atatgtcacttgaagaaggataacgagtggtacgcattcaatgacaccagaattaccaag
tccactaatccacccattcaccacggatacatttatctctttcagaagtcttaa

DBGET integrated database retrieval system