KEGG   Theileria parva: TP01_0359Help
Entry
TP01_0359         CDS       T00254                                 

Definition
mitogen-activated protein kinase 2
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
tpv  Theileria parva
Brite
Enzymes [BR:tpv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     TP01_0359
Protein kinases [BR:tpv01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   TP01_0359
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 642 aa AA seqDB search
MRSDKVIKKSVHDYERNDSKENNLLDRANSSLLSKSKSKYLEAENSGFKNYVTKQALLQS
RMSSVETDVPSTHYRSLISARKPEPQFNVYNQQENSVTAYNSSQTTNFNPNHITNYNSYN
SYNPNYNTNFTSNFNSNYTSNNEKVPESSAPLKDNYTGVSSTKYKPLKSSTIKKERPSIK
PAQSDIKWDLGERYKFVDMVGSGSYGHVCRAYDSQLNKFVAVKRIHKVFDDLIDCKRILR
EIAILNRLDHPNVVKILDILVPDNLETFDVLYVVLEIAASDIKQLVRSPAFLNENHIRLL
VFNLLSGVHYLHSVGIYHRDLKPANCLINRDCSVKICDFGLARTTTFPEEFMDSTSYSGR
QAEVSYSSRPVESISTSYSTSRSLPDYACGLGSSEKLISDTASGNATLNPYTNTVTVKGP
MRQIYRRQLTGHVVTRWYRAPELILLQENYSFAVDIWSVGCIFAELLNMMKVNVSDPCDR
SPLFPGSSCFPLSPDNKNANPRTTRENDQLNLIFNVLGTPSEEDINCIQKADVRRYVKFF
AKRSFQDLRTKFKGASLESIDLLKKMLTFNPDKRISVFDALNHPYFKSISKPRNNFDSIP
KVTLPFNDWVNMSESQLRYSFLREIQRYHKDFKIPVKIIYRS
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgagatcggataaggtaataaagaagagtgttcatgactacgagaggaacgactccaag
gaaaataatttacttgatagagccaactctagtctgctctcaaaatccaaatcaaagtat
ttggaggctgagaactcggggtttaagaactatgtgacaaagcaggctcttttacaaagc
agaatgagttcagttgaaactgatgttccatcaactcactacagaagcttaatttctgca
cgtaaaccagagcctcaattcaacgtctacaaccaacaggaaaattcagttacagcatac
aattcatcacaaaccactaattttaaccctaatcacatcaccaactataatagctataac
agctacaatcccaactataacaccaatttcacttctaacttcaacagcaattacactagt
aacaacgaaaaggtaccagaatcatcagctcctttaaaagataactacacgggtgtatct
tcaactaaatataaaccactaaagagttcaactattaagaaggaaaggccatcgattaag
cctgcccaaagtgatataaaatgggatcttggggaacgttacaagtttgttgatatggtg
ggctctgggtcatacggccatgtttgcagggcttatgactcacagctaaacaaatttgtg
gcagttaaaaggattcataaggtgtttgatgacttgattgactgtaaaagaattttgagg
gaaattgcaattcttaataggcttgaccacccaaacgtggttaagattttggacattcta
gtccctgacaatttggagacatttgacgttttgtatgtagttcttgaaatcgcagcttct
gatattaagcagttggtcaggtcgcctgcctttttgaatgaaaaccacattaggcttttg
gtgtttaatttgctttctggcgttcactaccttcactctgtcggcatataccacagggac
ttaaaacctgctaattgccttattaacagagattgcagtgtaaaaatctgtgactttgga
cttgctagaactactactttccctgaggagttcatggactccacttcttattctggaagg
caggctgaagtttcatactccagcaggcctgttgaaagtattagcactagttattcaaca
tcaagatcgttgcctgattacgcctgtggccttggttcttctgaaaaacttatttcagac
actgcatctgggaacgctacattgaatccatacaccaacacggtcactgttaagggtccg
atgagacagatttacaggagacagcttactggtcatgttgtaactaggtggtacagagct
ccagaactgattttacttcaagaaaattactcttttgctgttgacatttggtctgttggt
tgtatttttgctgaacttttaaacatgatgaaggtgaatgttagtgatccttgtgacaga
tctcctttgtttcctggaagttcatgtttccctctatcacctgataacaagaatgctaac
ccaagaaccactcgtgaaaatgatcagcttaacctaatctttaatgttctcggcactccg
tctgaagaggatattaactgcattcagaaggctgacgttcgtcgttatgttaaatttttt
gccaaacgcagtttccaggatctgaggactaaattcaagggtgcttctctagaatctatt
gatttgctcaaaaagatgctaacttttaaccccgacaagcgtatttctgttttcgatgct
ctcaatcatccctacttcaagtctatcagcaagcctaggaacaactttgattctattccc
aaagttactcttccctttaatgactgggttaacatgtctgaaagtcagcttcgatattct
tttttgcgtgaaattcaaagatatcacaaggactttaagatccctgtaaagataatatat
cgctcatga

DBGET integrated database retrieval system