KEGG   Theileria parva: TP01_0465Help
Entry
TP01_0465         CDS       T00254                                 

Definition
histone acetyltransferase Gcn5
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
tpv  Theileria parva
Brite
Enzymes [BR:tpv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TP01_0465
Transcription machinery [BR:tpv03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     TP01_0465
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 631 aa AA seqDB search
MKTKLSQQNLASNESTSSPGPSTPKSATEAKTISRPLASVNTELNSKNESITSYVREIVN
LYVLDCKKRPDPFQPTLEPKNSSKNSDSFSHLVLGGRDVSNIFRRSFETVPEPRRKDLLE
IRSILSTSNNEDLESLVNTLCAIISYQQLLTPTARQKFANEHLQAWLKSQDGEAFAGKDY
EKIYTSWKNYLRKHMPTGVKLCDYFSADFLRAVLVLNADRIRLELEKTAFKYHPDLFISL
LCKQCGFSDELANTIGTMSSAKGYQIQSLLPSETGLGFLHRDAGGAKEEDLGIITFECIT
NDREPGHMIKLITVKNIFSRQLPKMPREYIVRLVFDRNHYTFCLLKKGEVIGGICFRPYF
EQRFAEIAFLAVKSTEQIKGYGTRIMNHLKEHVKKSNIEYFLTYADNFAIGYFKKQGFSL
KITMPRERWFGYIKDYDGGTLMECYISPNINYLRLSDMLSQQKAIVVKCIEAIKPLKVYS
GLNVFNKNTTVTINPCDIPGLLEAGWTPTQTSNLNTLATSAEPEGQKKSLKASILELLNT
LNKQQSVWPFRKPVKQSEAPDYYEIITHPTDISTMKRKAKLGEYKTKEQFGEELKRMFDN
CRLYNTSHTIYYKYANELQAFIWPQYENIQE
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactaagctaagccagcagaatttggccagtaatgagtccacatcttcgccgggg
ccttcgacgccaaaatcagcaacagaggccaaaacgatatcacgtccactggcctctgta
aacacggaattaaattctaaaaatgagtcaataacttcatatgtccgggaaatcgtaaat
ttatacgttctggactgtaaaaaaaggcctgatccatttcagccgactttagagcccaaa
aactcatctaaaaattcagactcattttcacacttagttttaggtggccgcgacgtctca
aatattttcagacgctcatttgaaactgttccagagcccagaaggaaagatctgctcgag
atcagaagcatcttgagcacatctaacaatgaagatttggaatctttagttaacacactg
tgtgcaataataagttatcagcagcttttgacaccaactgcaagacaaaaatttgcaaat
gagcatctgcaagcttggctgaaatcacaagatggtgaagcatttgcaggaaaagactac
gaaaagatatacacaagttggaagaattatctcagaaaacatatgccgactggtgttaaa
ctgtgtgactacttttcagctgattttctcagagccgttctagtcctgaacgcagatcgc
ataagacttgaactagagaagacagcattcaaatatcatccagatctgttcatctcacta
ctctgtaagcagtgtggatttagtgatgaacttgcaaatacaattggcacaatgagtagt
gctaaggggtaccagatccagtcactgttaccatcagagacgggcctaggatttctacat
agagacgccggaggcgctaaagaagaagatttgggtataatcacctttgaatgtattact
aacgacagagaaccaggacacatgattaagctgatcacggtgaagaatattttctcccga
cagttgcctaaaatgccccgagaatacattgtgagacttgtgtttgatcggaatcattat
acgttctgtttacttaagaagggcgaggtgattggaggtatctgtttcagaccatatttt
gagcagaggtttgcagaaatcgcatttttagccgtgaaatccactgaacaaattaaaggc
tacgggaccaggattatgaaccacctcaaggaacatgttaaaaaaagtaatattgaatac
tttttaacctacgctgataattttgccattggctactttaagaaacagggcttctcactc
aagatcacaatgccccgggaacgctggtttggatacattaaagattatgacggaggcact
ctcatggaatgttacatatcaccaaatattaactatctcagacttagtgatatgctaagt
cagcagaaggcaattgtagtcaagtgtatagaagccattaaacctctcaaagtctacagc
ggtttaaatgtgtttaataaaaacaccactgtcaccataaatccctgtgatatacctggg
ctactagaggctggctggacaccaactcagaccagtaacctcaacactttggccaccagt
gccgagcctgagggacagaaaaaatcactcaaggcctcgatattagaattgttaaacact
ttaaataaacaacaaagtgtttggccctttaggaaacctgtaaagcaatctgaggcacca
gactactatgaaattattactcatcccactgacatctcaacaatgaaaagaaaggcaaaa
ctgggagaatacaagacaaaggaacaattcggcgaagaactcaagagaatgttcgataat
tgcaggctatataacacctcacacaccatctactacaaatacgcaaacgaactccaagca
ttcatatggccacaatatgaaaatattcaagaataa

DBGET integrated database retrieval system