KEGG   Theileria parva: TP01_0476Help
Entry
TP01_0476         CDS       T00254                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
tpv  Theileria parva
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpv00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    TP01_0476
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TP01_0476
Enzymes [BR:tpv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     TP01_0476
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 376 aa AA seqDB search
MKQYLHHSWVALGAGLVTVTALYALSYVPWVRTALTELGLYGCNPLLHCFDSVKRKVAST
LRNKGLLFVDDLTNSQLSCIFEVADFFRKKVTQGLNVELLFGKVMTTLFCEPSTRTRCSF
ETAMLKLGGKVVSVSDSTSSFTKGETIDDSVRVLSSYSDVLVLRHPETNVIQRVKHHCLV
PLINAGDGSGEHPTQALLDLYTINSYFPLFSSEKELTVCLVGDLKYARTTHSLVRLLSRF
NVVLRYVSTTSLQMPTQIQREVEQNFAKYNIPDLAFSRQTSFKKLTDALDNVDVVYVTRI
QRERMPPSEHPPKESFKIDKHVMSLLPKHAKVLHPLPRVDEVSTDVDSDERCVFFEQAEN
GLYVRMALLYLILNKD
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagtatttacatcattcatgggttgcccttggggctggacttgttactgttaca
gctttatatgccctttcatatgttccctgggtcagaactgctttaactgaacttggccta
tacggttgtaatcctctgcttcactgttttgattctgtgaagaggaaggtcgcttctact
cttagaaataaaggattattgtttgtagatgatttgactaattctcagctgagttgtatt
tttgaggtggctgactttttcaggaaaaaagttacacaagggttaaatgtcgaactcttg
tttgggaaggttatgaccaccttgttctgtgaacccagtactaggacaagatgctcattt
gagactgcaatgttaaagctaggtggcaaggtggtttctgtgagtgattctacctcttca
tttacaaaaggcgaaactattgacgactcagttagagttttatcatcatacagtgacgtt
ctagtgttacgtcaccctgaaactaatgtcattcaacgtgttaaacatcactgtctggtt
cctctgattaacgccggagacggttcaggggaacacccaactcaagcacttcttgacctc
tacaccattaatagttactttcccttattttcttctgaaaaggagcttacggtttgttta
gtaggggaccttaaatatgccagaactacgcactctcttgtaagacttttaagtcggttt
aacgttgttttgagatacgtctccaccacttcacttcagatgccaacccaaatacaacgt
gaagttgaacaaaacttcgccaaatacaatatcccggacttggcgttctcaagacagaca
agtttcaaaaagcttactgacgcgcttgataatgtggatgtcgtttatgtcacacggatt
cagagggaacggatgccaccttcagaacatccaccaaaggagtcttttaaaattgacaaa
catgttatgtcactactacccaaacacgccaaggtattgcatccgttgccgagagtggac
gaggtttctacggatgttgattccgatgagcggtgtgtattctttgaacaggcggaaaac
gggctctacgtccgtatggccctgctatatttgattttaaacaaggattga

DBGET integrated database retrieval system