KEGG   Theileria parva: TP01_0775Help
Entry
TP01_0775         CDS       T00254                                 

Definition
phospholipase C
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
tpv  Theileria parva
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:tpv00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:tpv04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 974 aa AA seqDB search
MSTQLNNLWMSSLSAGCANDSPALSELLSEHLKRVSLTDSLNLIFKGGYLRKWRRSSRLT
LSHPKNDNKALVASHGSSTTVYSSQSSGRSHELFFWVSKVCDTLFLRWQSKRKRSSESIF
PLCAVRSIHRGDELTYFDHKDPFDGVSLKFIFVINGKFSLQLAASSENDALMWISGLYFA
ARYARSEYSINWITNSDVFNSFLKSDKKKRTELGDCEFDSKALKRCLNDKYVSLVYLSDY
ENIRAEDSDFLLPQNLSQFVEYLGYCGVVSRPENVDVITSMVRRLLEFRNTINAGFLQMT
SQLDKNLKPIRVIKACMDHFDSLDLEYRVLHRDLIAIYPELTNQECEDVFYNIVRQCALR
VMLRTSTGKSEFIQQIQPADYELFLRNIQSSDSNEVVTNLLAVQDWLSPLSYIADNLPEL
KAVGCFRKVNIPRIPVRFLTLLGFNWSLTSNFNDICIPQDSDEIFSVLSLTLRDFWISSS
HNTYLIGDQLGGSATAGALAEALLRGCRCIELDCQDGAEEPVLCHAWKNCHLTGSVTLRE
GLIAIKESAFESNKLPVILSFEMHCSDEFKFQSFELVTQILGDELLTLDNDDPVDLVARC
ELGNLLNKFLIKAKYKSSENAFLGPGEIAWQSLITLRGIDIDKVDEKKIETLKRNSVFAI
SETKFIKISKEPSLLNALAERCFVRVYPSATRLASTNFCPVKPWSHGVQFAALNFQSFDR
SMLINYGRFYHSFGYVPKLIYKNSSDYGGNSKYDHEKAINSDKINNDLILTLHVLSGSQL
PTPNVFQDRNYVNSFNNVLYSVGEENMFLDKSNLKAPKFAKSKEKRKLKQAIKQGLEVDE
EDTNGTTLFNVIDKSARTVLDHRQKVCPFVEVSVVGEDENTCKTKPVNFNTFNPVWSDSN
PPFTFKIRNPNEAILLFYVKHYDSISSEVLGQAAFPVNRLRPGIRWVQLLDSKFMEIDCS
GLLVHIEMQPLKNP
NT seq 2925 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactcaattaaataatctttggatgtccagcttatcagcgggatgtgcaaatgac
agtcccgctttaagtgaactcttatctgaacatttaaagcgagtttctcttactgattca
ttaaatttaatatttaagggcggatatttaaggaaatggcgtagatcatctcgtttaacc
ttatctcatcccaaaaatgacaataaagcacttgttgcatcacacggaagttccactacc
gtttacagttcccaatcttctggacgttcacatgagctgttcttttgggtttcaaaggtg
tgcgacacacttttccttcgctggcaatcgaaaagaaaacgcagcagcgagagtattttc
ccgctctgtgctgtaagaagtatacacagaggtgatgagttgacctacttcgatcacaag
gatcccttcgacggcgtgagcctgaaatttatcttcgttatcaacgggaagttttcacta
cagctggcagcatcgtctgagaatgatgcacttatgtggatctcaggcctctatttcgca
gccagatatgcacgaagtgaatattcaatcaattggataacaaactcagatgttttcaac
tcatttctcaagtcagacaagaagaaacgaacagaacttggcgactgtgagtttgattcg
aaagctttaaagcgttgtcttaacgacaaatacgtcagtcttgtatacttgagtgactat
gagaacatcagggctgaggactcagacttcttattaccccaaaacttgtctcagtttgtt
gaatatttagggtattgtggagtagtttccaggcccgaaaatgttgatgttataacatca
atggtacgcagactccttgagttcagaaataccattaacgccggatttttacagatgacc
tcacagcttgacaagaatttgaagccaattcgtgtcatcaaggcatgtatggatcacttt
gattcactagacttggaataccgtgtcctacatagagacctgatagctatttacccagaa
ctcacaaatcaagaatgcgaggacgttttttataatatagtaagacagtgtgctctaaga
gttatgctgagaacatcaacagggaaatctgagttcattcagcagattcaaccagcagac
tatgaactatttctgcgtaacattcagtcctctgattctaacgaagtggttacaaatttg
cttgcagtacaagactggctgtcccctttatcgtatatagccgataatttgcctgagtta
aaggcagttggctgtttcaggaaagttaatattcccagaattcctgtgagattcctgaca
cttttaggctttaactggtcactcacgagtaattttaacgacatttgcatacctcaagac
agtgacgagattttctcagtattgagtttaaccttgagggatttctggatatctagtagt
cacaacacctacttgattggagatcaattgggaggttcagccacggccggtgctctagca
gaagctcttctccgtggatgcagatgcatagaacttgactgtcaagacggcgctgaagag
ccggtactttgtcacgcttggaagaactgtcacttgacagggtctgtgacccttcgtgaa
ggccttatcgcaataaaagagtccgcctttgagtccaataaattacctgtaattttatcc
tttgaaatgcactgctcagatgaattcaaattccagtcctttgaacttgttactcagata
ctgggagatgaactgttgactttggacaatgacgaccctgttgacttagttgcccggtgt
gagctgggcaatttgctaaacaagttcttgataaaggcaaagtataaatcatctgaaaat
gcatttttaggtccaggcgaaattgcttggcaatcgctaataactttgagaggtatagat
atagataaagtcgatgaaaaaaaaatcgagacacttaagcgtaactctgttttcgctatt
tccgaaactaaattcattaaaatatcaaaggaacctagtttattgaatgcgttagctgaa
cgttgttttgtacgggtttacccatcagcaacaagacttgcaagtactaatttttgccct
gtaaagccttggtcacacggagttcaatttgcagccctaaactttcaatctttcgaccgg
tcaatgctgattaattatggccgtttctaccattcgtttggatatgtaccgaaacttatc
tacaaaaactcgtcagattatggcggtaattctaaatatgatcatgaaaaggctataaat
agtgataagattaataatgatttaatattgactttacatgttttaagtgggtcccagtta
cctactccaaacgtgttccaggatagaaattacgtcaattcttttaataacgtgttatat
tcagttggagaggagaatatgtttcttgataaaagtaatttgaaggcgccaaaattcgca
aaatcaaaggagaagcgtaaacttaagcaggcaataaagcaagggttagaagtagatgag
gaagatactaatggcaccacattgtttaacgttattgacaaatctgcaagaaccgtttta
gaccacaggcagaaggtttgcccttttgtcgaagtttcagttgttggtgaggacgaaaac
acctgcaagacgaaacctgtaaactttaacaccttcaatcctgtctggtcggactctaat
ccgccctttactttcaaaattcgtaaccccaatgaggcgattcttctcttttacgtgaag
cactatgacagcatttcttctgaagttttaggtcaggctgcttttcccgtcaacaggtta
cggccaggcatccgctgggttcaattgctggactctaagtttatggaaatcgattgttca
ggtttattagtacacattgagatgcaacccttgaaaaatccatga

DBGET integrated database retrieval system