KEGG   Theileria parva: TP01_0989Help
Entry
TP01_0989         CDS       T00254                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
tpv  Theileria parva
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:tpv00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    TP01_0989
  Replication and repair
   03420 Nucleotide excision repair
    TP01_0989
Transcription machinery [BR:tpv03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     TP01_0989
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 359 aa AA seqDB search
MVDPAKKNYKTTKTVGTKMSRQTLSWLLKDVTSQMTSLLVGHLQNLDNGYLTNCKSMNRS
SEDSKKSSLELKEASFKTVTESVELLLSLSQASCGDCFSTEGLTKTQLRLLRLLNELGIV
YYKNPKKFYLYDLSYIVGKTNTNTGLPTSKDLDLSIKAGNDSRIIVQSNFKVYVYTASPL
QISVLSHLCELQARTPNLVVGVLTRESVQSAFKSGITSKEIIRFLSPNGMNSSIGNQENT
LLNSTFTYSIPENVCRQLKMWESERDRIELCPSIVFKRWDQDFMPDLFQRTVRWAQSKRY
ELFYTQWPSDPHSPEYQEWILKEKYLACDLEFKDEVINQIRLIRADISAERQARISGGQ
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggtagacccagccaagaagaattataagaccaccaagaccgttggaaccaagatgagt
agacagaccctgagttggttactgaaggatgttacgagtcagatgacgtcactcctagtt
gggcacttgcagaacctggataacggctacctgacgaactgcaagtcaatgaacaggagt
tcagaagactccaaaaaatcatctttggagttgaaggaagcgtcatttaagacagtaaca
gagtctgttgagcttttgctgtcattgtctcaggccagttgcggagactgcttctcaact
gagggcctaacaaaaacgcagcttaggctcttaagacttctcaacgaactaggaatagtc
tattacaagaaccctaaaaagttttatttgtacgatttatcgtatatagtggggaaaaca
aatacaaacactggactgccaactagcaaggacctggatttaagtataaaagctggtaac
gatagcagaattatagtgcagagtaattttaaagtgtatgtgtacacagcaagcccactc
caaataagtgttttgagtcacctgtgtgaactccaagcaagaacgccaaacctagttgta
ggagtattaacaagagaaagtgtacagtcggcgtttaagtcaggaattacgtctaaagag
atcatcagatttttgtcacccaatggtatgaattcatctatcggaaaccaggaaaacaca
ctactgaactcaacatttacctacagcataccagaaaatgtgtgtagacagcttaaaatg
tgggaatctgaaagggatagaatagagttgtgcccgtcaatagtgttcaaaaggtgggac
caggattttatgcctgacctcttccaaagaacagtaagatgggctcaaagtaagagatat
gaacttttttatactcagtggccatcagatccacactctccagaataccaagaatggatt
ttgaaggaaaaatacctggcctgtgacttggaatttaaagatgaagtaattaaccaaatt
aggttaattagagctgatatttcagctgaaagacaggctagaattagtggtggtcaatga

DBGET integrated database retrieval system