KEGG   Theileria parva: TP02_0073Help
Entry
TP02_0073         CDS       T00254                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
tpv  Theileria parva
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tpv00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TP02_0073
Enzymes [BR:tpv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     TP02_0073
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 401 aa AA seqDB search
MGSTGSVGTQALDVIRNINKLESNSGPKFEVVALTANSNYKLLSQQVNEFRPEVCHILKN
YEKMPELLKTKCKILNEKSDLMDLCRNFDYDIILMAISGCDGIEPTLAAAKSGKKIALSN
KESVVSAGSLLSKVVKKSKTTVLPVDSEHNAIFQCLDDGTVDTRKSTYVCSISSQALAKV
KNLILTSSGGPFNGKKYTEYKNLRSTDNINHPVWQMGSKITVDSSTMMNKALEVLEAHHL
FGLPLDSIKILVHKECVVHSLVEFIDNSVLCQMYLPDMKLPISHALHWPNRTKNALPSLD
LRGRNLSFKEADYENFPFLGLGYEVGRMGGLYPAVFNAANDVANGLFRSNKIDYEKLYQI
VRETVESFNKPDLSDDILQDILYADSWAKDTANRMYSKVAI
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgggctcaactggttcagttgggacacaagcactggacgttattaggaacataaataaa
ttggaaagcaattcaggaccaaaatttgaggttgtagcactaacggcaaatagtaactat
aaactactgtctcagcaggttaacgagttcaggcctgaagtttgccacattttaaaaaac
tacgaaaaaatgcctgaattattgaaaaccaagtgtaaaatattaaacgaaaagtctgac
ttgatggatttatgtagaaattttgattatgacataatactgatggcaatttcaggctgt
gatgggatagaacccacactggccgcagcaaaaagtggtaaaaaaatcgcactttcaaat
aaagaatcggtggtttctgctggaagccttttaagtaaagtagttaagaagtcaaaaaca
acagtgctaccggtggactcggagcataatgcaatttttcagtgtctggatgatggcaca
gttgataccagaaaatcaacttacgtgtgtagcatatcatcgcaggccctagctaaggtt
aagaatttaattttaacgagtagtggaggtccatttaacggcaaaaaatatacggagtac
aaaaacctaaggagtacagataatataaatcacccggtttggcaaatgggctctaagatc
actgttgattcttcaacaatgatgaacaaagcactagaggttttagaagcgcaccatctc
tttggactacctctagatagtattaaaatcctagttcacaaggagtgcgttgttcattct
ctagttgagttcatcgacaattcagtgctgtgtcaaatgtatttgcctgacatgaaactt
cctatatctcatgcattgcattggcctaacaggaccaaaaatgctcttccatcacttgat
ttaaggggccgaaatctcagtttcaaggaggccgactatgaaaatttcccatttttaggt
ctcggttacgaagttggcaggatgggtggtctttaccctgcagttttcaatgctgccaac
gacgttgcaaacggtttatttaggtctaataaaatagattacgaaaaactttaccagatt
gttcgtgaaactgtagagtcgttcaataaacctgacctcagtgatgacattttacaggac
atattgtacgccgattcatgggcaaaagatactgcaaacagaatgtattccaaggtggca
atttga

DBGET integrated database retrieval system