KEGG   Theileria parva: TP02_0111Help
Entry
TP02_0111         CDS       T00254                                 

Definition
hypothetical protein
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
tpv  Theileria parva
Brite
Enzymes [BR:tpv01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     TP02_0111
Peptidases [BR:tpv01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TP02_0111
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 258 aa AA seqDB search
MLYNYLDDFILGDQQDAHEFLTYILNAMIDEIRNLEDEYVKPKTFMSSKSGGKRKLEKKT
WLNELVEGCVKSETRCHECYSVTGMTEPFITLSLNIFDNCDINLCLQRYCDDELLSGKNQ
FFCEKCDKYCDASKRIVFDLMPPLLILHLKRFKYTTKPGSSLCSVYERLPYSVVCSNVIQ
VNCKRHPCPIVYELFSIISHIGTSPDYGHYINISELGGNWFRCDDASILKLDDYHSEIGD
ETTSGNDASYILFYRIKE
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgttatacaattatttagatgattttatactcggagaccagcaggatgcacatgaattt
ttgacttatatacttaacgctatgatagatgaaatcagaaacttagaagacgagtatgtt
aaacctaaaacatttatgagctctaaaagtggcgggaaaagaaaacttgagaagaaaacg
tggttaaatgaattggtggaaggatgtgtaaaatccgaaacaagatgtcatgaatgctat
agcgttactggtatgacagaacctttcataaccctctcactcaatattttcgataactgt
gatataaacctttgtttgcaacgctattgcgatgatgaacttctctctggtaaaaaccag
ttcttttgtgagaagtgtgataagtattgtgacgcgtcaaagagaatcgtctttgacctc
atgcctcccttattaattttacacttaaagaggtttaaatataccaccaaaccgggaagc
tcactgtgttcagtgtatgaaagacttccatactcagtagtgtgctctaacgtaattcag
gtaaactgtaaacggcatccatgtcccatcgtctacgaactattctcaattatctcacac
attgggacatctcccgattacggacactatataaacatttccgaactcggaggaaattgg
tttagatgtgacgatgcttccatcctaaaactcgatgactaccactctgaaatcggggat
gaaaccacctcggggaacgacgccagttatatcctgttttatcgcatcaaagaatag

DBGET integrated database retrieval system