KEGG   Theileria parva: TP02_0350Help
Entry
TP02_0350         CDS       T00254                                 

Definition
serine/threonine protein phosphatase
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
tpv  Theileria parva
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:tpv03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 301 aa AA seqDB search
MELNLDSIIERLLEVRGNRPIKSVQLSEEEIKGLCHKSREIFLSQSILLELEAPIKICGD
IHGQYYDLLRLFEYGGFPPAANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGN
HECASINRIYGFYDECKRRYSIKLWKAFTDCFNCLPVAAIIDDKIFCMHGGLSPELTTMD
QIRQISRPTDVPDTGLLCDLLWSDPDSNTTGWGENDRGVSFTFGSDIVVNFLAKHELDLI
CRAHQVVEDGYEFFSKRRLVTLFSAPNYCGEFDNAGAMMSVDKTLMCSFQILKPVDRKRL
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggaacttaacttggacagtatcatcgaacgactgctggaggtcagggggaaccgtcca
atcaagtcagtacagctaagcgaggaggaaattaagggactttgccataaaagccgagaa
atcttcttatcgcaatccatattgctggaattagaagcgccaattaaaatttgcggtgat
atacacggacagtattacgacctcctcagactgtttgagtacggaggcttcccgccggcg
gcaaattacctgtttctgggagattatgtggatcgaggcaagcaaagccttgaaaccata
tgccttcttctcgcttataaaatcaaataccctgaaaatttctttttattacgtggtaat
cacgaatgtgcgtcaataaatcgaatttacggattctacgatgaatgtaaacgcagatat
agcattaaactatggaaagcattcacggactgctttaattgcctaccagtcgcagccata
attgatgacaagatcttctgtatgcatggcggactttctccggaattgacaaccatggat
caaataagacagatctcaagacctactgatgtcccggacaccggtcttctctgcgatctt
ctttggagcgaccctgactcgaatactacagggtggggagaaaatgaccgcggggtctca
tttaccttcgggtcagacatagtggtcaacttccttgccaaacacgaactggacctgatt
tgtcgtgcgcatcaggtggtggaagacggatacgagtttttttcaaagagaaggctcgtc
accctgttcagtgctcccaattactgcggagagtttgacaacgcaggcgccatgatgagc
gtcgataagacactgatgtgctcatttcagatccttaaacctgttgatcgaaaacggtta
aaatga

DBGET integrated database retrieval system