KEGG   Theileria parva: TP02_0350Help
Entry
TP02_0350         CDS       T00254                                 

Definition
serine/threonine protein phosphatase
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
tpv  Theileria parva
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:tpv00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    TP02_0350
Enzymes [BR:tpv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     TP02_0350
Protein phosphatases and associated proteins [BR:tpv01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     TP02_0350
Transcription machinery [BR:tpv03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     TP02_0350
Spliceosome [BR:tpv03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    TP02_0350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 301 aa AA seqDB search
MELNLDSIIERLLEVRGNRPIKSVQLSEEEIKGLCHKSREIFLSQSILLELEAPIKICGD
IHGQYYDLLRLFEYGGFPPAANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGN
HECASINRIYGFYDECKRRYSIKLWKAFTDCFNCLPVAAIIDDKIFCMHGGLSPELTTMD
QIRQISRPTDVPDTGLLCDLLWSDPDSNTTGWGENDRGVSFTFGSDIVVNFLAKHELDLI
CRAHQVVEDGYEFFSKRRLVTLFSAPNYCGEFDNAGAMMSVDKTLMCSFQILKPVDRKRL
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggaacttaacttggacagtatcatcgaacgactgctggaggtcagggggaaccgtcca
atcaagtcagtacagctaagcgaggaggaaattaagggactttgccataaaagccgagaa
atcttcttatcgcaatccatattgctggaattagaagcgccaattaaaatttgcggtgat
atacacggacagtattacgacctcctcagactgtttgagtacggaggcttcccgccggcg
gcaaattacctgtttctgggagattatgtggatcgaggcaagcaaagccttgaaaccata
tgccttcttctcgcttataaaatcaaataccctgaaaatttctttttattacgtggtaat
cacgaatgtgcgtcaataaatcgaatttacggattctacgatgaatgtaaacgcagatat
agcattaaactatggaaagcattcacggactgctttaattgcctaccagtcgcagccata
attgatgacaagatcttctgtatgcatggcggactttctccggaattgacaaccatggat
caaataagacagatctcaagacctactgatgtcccggacaccggtcttctctgcgatctt
ctttggagcgaccctgactcgaatactacagggtggggagaaaatgaccgcggggtctca
tttaccttcgggtcagacatagtggtcaacttccttgccaaacacgaactggacctgatt
tgtcgtgcgcatcaggtggtggaagacggatacgagtttttttcaaagagaaggctcgtc
accctgttcagtgctcccaattactgcggagagtttgacaacgcaggcgccatgatgagc
gtcgataagacactgatgtgctcatttcagatccttaaacctgttgatcgaaaacggtta
aaatga

DBGET integrated database retrieval system