KEGG   Theileria parva: TP02_0396Help
Entry
TP02_0396         CDS       T00254                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
tpv  Theileria parva
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpv00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    TP02_0396
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 115 aa AA seqDB search
MAKPEPDVVIPEGDSSKGAKLFKSKCAQCHTINKGGSVKQGPNLYGFYGRKSGASDYAYS
DANKNSGIVWSDKHLFVYLVNPKQYIPGTKMVFAGLKKEQDRADLIAYLKEASSK
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaccggaaccagatgtagttattcctgaaggagattcctcaaaaggagccaaa
ctcttcaagtcaaaatgtgctcaatgtcacacaataaacaaaggaggaagcgtgaaacaa
ggccctaacctatatggattttatggccgtaaatctggcgcaagtgattacgcatattct
gacgcaaataaaaattctggcattgtatggtctgataagcatctttttgtgtacctggtt
aatcccaagcagtatattccaggaacaaaaatggttttcgccgggttaaagaaggaacaa
gaccgagcagatttaatagcgtatctgaaggaagcttcttccaaataa

DBGET integrated database retrieval system