KEGG   Theileria parva: TP02_0576Help
Entry
TP02_0576         CDS       T00254                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
tpv  Theileria parva
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:tpv00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    TP02_0576
Enzymes [BR:tpv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     TP02_0576
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 193 aa AA seqDB search
MSEDLPILVIVGPSGSGKTTLNARLIEDYPQVFENSISYTSRAMRPNERDGVHYNFVSKE
EFDQMYVDGEFVEFTTFVGFQYGTARSELERIQKLGKVPVLEIDIKGYKQLLDANLRLKG
VFIEPPGLEILRERLIKRGCNTEESINKRVERANQELEESRDCYFDARLPNEDLDVAYKE
FVNVLSQWYHIKP
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaggatttaccgattttggtgattgtgggcccttctggttctggtaagacaacg
ttgaatgcgaggttaattgaggattacccccaggtatttgagaactcaattagttataca
agccgtgcaatgcgtccgaatgagcgtgacggggtgcattataactttgtgtctaaggag
gaatttgatcaaatgtacgtcgacggcgagtttgtggagtttacaactttcgtgggattt
cagtatggaacagcccgatcagagctggaacggatacaaaaactaggcaaagtcccggta
ctggaaattgatattaaaggctacaaacaactgttagatgcaaatttgaggttaaagggc
gtgtttattgagccaccaggacttgaaatcttaagggaaaggttaattaaaagaggttgc
aacactgaggaatcgataaataaaagagttgaaagagctaatcaggaacttgaagagtca
agggattgctacttcgatgccagactaccaaacgaagatctggacgttgcatacaaggaa
tttgttaatgtcctctcacagtggtatcacatcaaaccataa

DBGET integrated database retrieval system