KEGG   Theileria parva: TP02_0656Help
Entry
TP02_0656         CDS       T00254                                 

Definition
choline kinase
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
tpv  Theileria parva
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpv00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    TP02_0656
Enzymes [BR:tpv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     TP02_0656
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 384 aa AA seqDB search
MLNFPNRDTLPGLEHDNKTKFDSLTFKYDYSHSNLKSICIQHVPFWTNINPDFIEVKDAN
AGIFNRVYIIKLNSSDKDKYPYKKITLKKKADFNSLVVNNDLQYNVAKLLGDNNFGPKII
GRFGDFTIQEWVEGDTLTNDSLQNLSVLTGIASSLAKFHKRVTELVPKEWDRTPMFLTKI
SVWSQHVERIIKKHNLDFDYTELKHNYELFKRILSNHLNTSNSIANSVLFCHNDLFFTNI
LDINQGMYLIDFDFAGFNYVGWEIANFFLKPGIVHLNDPPAQFYLDDSLALTNEMKTFFV
SVYLSQLLGRNVLASDDVVKEFLQSLEIHTLGVNLFWTYWGIVMSDKPKNQLNFDVLFHV
QSELMYNLFKTNLRRLTDNKIINF
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgttaaactttcccaaccgtgatactttaccaggtttggaacatgataataaaacgaaa
ttcgactctttaacatttaaatatgattacagtcatagtaatctaaagagtatatgtatt
caacacgtcccattttggactaatattaatcctgatttcatagaagtcaaagatgccaat
gctggtatatttaatagagtttatatcataaaattaaactcatcagacaaagacaaatat
ccatacaaaaaaataactttaaagaaaaaggcagatttcaattcgttagtggtcaataat
gatttacaatacaatgttgctaaattactaggagataataattttggtcctaagataata
gggcggtttggtgactttactattcaggaatgggttgagggtgatacactaacgaatgat
tcattacaaaacctctcagttttaacagggatcgcttcatcacttgccaagttccataaa
agagttacagaacttgttccgaaggaatgggatagaacccctatgttcttaaccaaaata
tctgtatggtctcaacatgtcgagagaataatcaaaaaacataatctggattttgattac
actgaattaaaacataactatgagttatttaaacggatccttagcaatcacctaaataca
tcaaattcaatagctaattcagtcttgttttgtcataacgacttattttttactaatata
ctcgacattaatcaagggatgtatttgattgatttcgatttcgcagggttcaactatgta
ggatgggaaattgcaaatttttttttaaagcctggcatagttcacctaaacgatccacct
gcacagttttatttagatgattcactagcattaactaacgaaatgaaaacctttttcgtt
tcagtatatctttctcagctattagggaggaatgttttagcatcagacgatgtcgtaaag
gagtttctacaaagcttagaaatacacacgttaggagtgaatttgttttggacatactgg
ggaatagtaatgtctgacaaaccgaaaaatcagcttaattttgatgttctttttcacgtt
cagtccgaattaatgtacaatttgttcaaaaccaatcttaggagattaactgataataaa
attataaatttctaa

DBGET integrated database retrieval system