KEGG   Theileria parva: TP02_0659Help
Entry
TP02_0659         CDS       T00254                                 

Definition
(RefSeq) choline kinase
  KO
K00866  choline kinase [EC:2.7.1.32]
Organism
tpv  Theileria parva
Pathway
tpv00564  Glycerophospholipid metabolism
tpv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpv00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    TP02_0659
Enzymes [BR:tpv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     TP02_0659
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Choline_kinase APH
Motif
Other DBs
NCBI-GeneID: 3501914
NCBI-ProteinID: XP_765225
UniProt: Q4N4I1
Position
2
AA seq 385 aa AA seqDB search
MLTSSNHGSSLGLEQHNKIKFGSLTFKYDNSHSNLKNLCIQHVPFWNNLNHECIKVEPML
NGITNQVYRLSLTIPDNTYAIKSVCVKKTSTYNSLVFDNDLQYNVAKLLGDNNFGPKIIG
RFGDFTIQEWVEGDTLTNDSLQNLSVLTGIAASLAKFHKRVTELVPKEWDRTPMFLTKIS
VWSQHVERIIKKHNLDFDYTELKHNYELFKRILSNHLNTSNSIANSVLFCHNVLYNTNVL
ETQHEVCFIDFDFAGFNYVGWEIANLFVKLCVVYNDDSPPYTNEFDSNVLTNEIKSFFVS
VYLSQLLGRNVLASDDVVKEFLQSLEIHTLGVNLFWTYWGIVMNDKPKNELSRPVKLYVH
GFFEYNLFKSNLKKLNDDEIVNYQI
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgttaacctcttcaaaccatggtagttcactaggcttggaacaacataacaaaatcaaa
tttggttctttaacatttaagtatgataacagtcatagtaatctaaagaatctatgtatt
caacatgtaccattctggaataacctgaatcatgaatgtataaaggtagaacctatgtta
aatggaataacaaatcaagtatataggttaagtttgacaattcctgacaatacctatgca
attaagtcagtatgtgttaaaaaaacatcgacatataattcgttagtatttgataatgat
ttacaatacaatgttgctaaattactaggagataataattttggtcctaagataataggg
cggtttggcgactttactattcaggaatgggttgagggtgatacactaacgaatgattca
ttacaaaacctctcagttttaacagggatcgctgcatcacttgccaagttccataaaaga
gttacagaacttgttccgaaggaatgggatagaacccctatgttcttaaccaaaatatct
gtatggtctcaacatgtcgagagaataatcaaaaaacataatctggattttgattacact
gaattaaaacataactatgagttatttaaacggatccttagcaatcacctaaatacatca
aattcaatagctaattcagtcttattttgtcataacgttctgtacaatacaaatgtttta
gaaacccaacatgaagtttgttttattgactttgattttgctggatttaattatgttggc
tgggaaattgcgaatcttttcgtcaaattatgtgttgtttacaacgatgattcgcctcca
tacactaatgaatttgattccaatgttttaactaacgaaattaaatcctttttcgtttca
gtatatctttctcagctattagggaggaatgttttagcatcagacgatgtcgtaaaggag
tttctacaaagcttagaaatacacacgttaggagtgaatttgttttggacatactgggga
atagtaatgaatgacaaaccgaagaatgaactatcgaggccagttaagttatatgttcac
ggatttttcgaatataatttatttaagagtaatctaaagaaattaaacgatgatgaaatt
gtaaattaccaaatatag

DBGET integrated database retrieval system