KEGG   Theileria parva: TP02_0725Help
Entry
TP02_0725         CDS       T00254                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tpv  Theileria parva
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpv00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    TP02_0725
Enzymes [BR:tpv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     TP02_0725
Exosome [BR:tpv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TP02_0725
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 499 aa AA seqDB search
MFILINYGSSKSYCINRSGNPINPVYPVRLIHEYPGIKWCEHDPNEIMDSVYYTMNESVK
QLKEKVPNFVLVGLGVTNQRETVVVWDKDTGKPLHNAIVWLDIRASTEANNMVELYGSDR
HFYHINGLLISTYFSAFKLKWMSNNLDWFDKRVREESVRIGTIDTWIIYNLTGEFLTDIT
NASRTFLMDINTEKWSTEMLKIFGLTGNLLPKIRPNCSDFGTINNDKVPGFKGVKILGSA
GDQQASCIGQGLFENLATKCTFGTGAFILTNTGSKKVMSTGGLLCTPCYKLSPTTPTVFA
LEGSIAIAGAGITWLQDMGLLSDPSEISEILKKIKSSDGVVFAPAFSGLFAPRWRNDARG
SIMGMTQHTERGHIVRAYCESIGLQLYEIIHSFLSDTGLLSIPYINVDGGLSQNSELVQL
ISDLTDTRLERPENAEITSFGAALLAGLQAKLWDGLTEVKKFTNGANNTVWTPSMSPEQR
TTIIKYWNLGIERSLSWHL
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgttcatcttaatcaactatggatccagtaaaagttattgcatcaatcgatcagggaac
ccaatcaacccggtgtaccctgtacgactcatccatgaatatcctggcatcaaatggtgt
gaacatgatcccaacgaaataatggattccgtctactacacaatgaacgaatcagtaaag
cagctgaaagaaaaggttccgaatttcgttcttgtgggcttgggagtaacaaaccaacga
gaaacagtagtggtctgggataaagatacaggaaaaccattacataacgcaatagtttgg
ttggacatcagagctagcacagaagctaacaatatggttgaattatatggttcagaccgc
catttctatcacataaatggattattgataagtacatacttttcagcatttaaactgaag
tggatgtcgaataatttggactggtttgataaaagagttagagaagaatccgtaagaatt
ggaacaatagacacctggatcatatataacctaactggtgaattcttgacagatattaca
aacgcatcaagaacattcttaatggatattaacactgaaaaatggtctacggaaatgcta
aaaatatttggactaactggtaatttacttccaaaaataagaccaaattgttctgatttt
ggaactattaataatgataaggtgccaggatttaagggagttaaaatactaggatcagcg
ggagatcagcaagcatcctgcataggtcagggattatttgaaaacctggcaactaaatgc
acgtttggaacaggggcatttatcttgacgaatacaggttcgaaaaaagtgatgtcaacc
ggtggtttactatgcacaccatgttataaattgagcccaacaaccccaacagtgtttgca
ctagagggctccatcgcaattgccggagctggaattacctggttacaagatatgggacta
ttatcagacccctcagagatctcagaaatattgaaaaagatcaagtcctcagacggcgtg
gttttcgcaccagcatttagcggtttgtttgcaccgagatggagaaatgatgccagagga
agcataatgggtatgactcagcacacggaacgtggtcacattgtaagagcatactgcgaa
agcattggactacaactttacgagattatccactcttttctttctgataccggcctatta
tcaatcccttacattaatgtggatggaggattaagtcagaattcagaactcgttcaactc
atatctgatttaacagatacaaggctagaaagaccagaaaatgccgaaatcacatcattt
ggagcagcactgttggcaggactacaagctaagttgtgggatgggttgacagaagtgaag
aaatttacaaatggagcaaacaatacagtttggacaccttcaatgtcacctgaacaaaga
accaccatcattaagtactggaacctgggaattgaaaggtcgctatcatggcatttatga

DBGET integrated database retrieval system