KEGG   Theileria parva: TP02_0727Help
Entry
TP02_0727         CDS       T00254                                 

Definition
cAMP-dependent protein kinase catalytic subunit
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
tpv  Theileria parva
Brite
Enzymes [BR:tpv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     TP02_0727
Protein kinases [BR:tpv01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   TP02_0727
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 511 aa AA seqDB search
MAFCGSSPNVPTYRIKFIHFIKRSGKFIKLIILFPFKRKMYSCNDVRTSSSCKTGFKTKP
SMNTLVTEGHCNSSYNNICCKSSVGSSSKSITKCNVKVLKRCLNYRRSNTADSLCCNRVS
DFEACSRELNLDQSYRQYPSFKEKQTLFKNCKRDDFEIGKTIGTGSYATVCIAKFTPNNR
YFDLTRYLYPDIRENVNTSFARYTSQDSEQGYYNQIHDIEKPMEPNEKIVSLKILSKNKI
IEKRQLEHVKNEKNILSTLKHPFIVGYLGSFQDTLNLYFILEFVPGGELFTYLRRMHTFP
PEYTRFYASQVLLALDYLHMNKLVYRDLKPENILLDIMGYIRLVDFGFAKRLESGKTYTV
CGTCDYLAPEIFLKKGHDFRADFYSFGVFLYELLTGVPPFYSNSPQKTYKLALNNEVAFG
RKVNNVSRDIIKNLLRVDPSKRLGNNVKEVYFHPFFDGIDFNMLLAKQIKAPIVPSVSSH
DDVSNFIKYPESWDQYKSEITKEQQQLFQFF
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggctttctgtggatcctcgccaaatgttccaacctatcgtattaaatttatacacttc
atcaaacgtagcgggaaattcataaagctgataatattatttccattcaagaggaaaatg
tatagttgtaatgacgtaaggacaagtagcagctgtaaaacaggttttaaaacaaaaccc
agcatgaatactctggtaactgaaggtcattgcaatagtagttataacaatatttgttgc
aaaagtagcgtaggtagtagcagtaaatctatcaccaaatgcaacgttaaggttttgaaa
agatgcctaaactaccgccgtagtaacacagcggattctttatgttgtaatcgagttagt
gattttgaagcttgttctagagagttgaacctagaccaatcctatagacaatatccctcc
tttaaagaaaaacaaaccctgtttaagaattgcaaaagagatgactttgaaattggaaag
actatcggcacaggctcttacgcaacagtctgtatagccaagttcactccgaataatcgc
tattttgatctcaccagatatctgtatcctgacatcagggaaaacgtgaacaccagtttc
gcaaggtatacatcacaggattctgaacaaggatactataaccaaatacatgatatagaa
aaaccaatggaacctaacgaaaagatagtttcattgaaaatactgagtaaaaataaaatt
attgagaagaggcagctggagcacgtgaaaaacgaaaagaatatcctgagcactctaaag
cacccattcatagtaggatacctgggaagctttcaggacactctaaatttatatttcata
ctggagttcgtcccgggaggggaactttttacatacctaagaaggatgcatacgtttccg
ccagaatacactcgcttctatgcatctcaagtactccttgcacttgactacttgcatatg
aacaagctggtatacagagatttgaagccagagaacatccttcttgatattatgggttac
attaggctggttgacttcgggtttgcaaagagactggagtctggtaaaacatatacagtg
tgtgggacatgcgattacctggctcctgaaatttttctaaagaaaggccatgattttaga
gctgacttctactcatttggggtatttctgtacgaactgctgactggagtccctcccttc
tactcaaattcacctcaaaaaacgtataaacttgcgctgaataatgaagtggcctttggc
agaaaggtgaataacgtgagtcgagacatcataaagaatttgcttcgagtggatccctct
aaaagacttggaaataacgttaaggaagtttatttccaccctttttttgacggaattgat
ttcaacatgctgttggcaaagcagataaaggccccaatcgtacccagcgtcagcagccac
gacgacgtgagtaattttataaagtatcccgagtcttgggaccagtacaaaagtgaaata
acaaaggagcagcagcaacttttccagtttttttaa

DBGET integrated database retrieval system