KEGG   Theileria parva: TP02_0735Help
Entry
TP02_0735         CDS       T00254                                 

Definition
translation initiation factor E4
Orthology
K03259  
translation initiation factor 4E
Organism
tpv  Theileria parva
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:tpv03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 221 aa AA seqDB search
MAESASVAVNGTKKCPSLTFNKNTEDHAKLSELFESTTINLDTPLSLKNKWVIWEQIVKM
PEHSQNDYKEHTKPLVSFDSVQAFWNLWFNIPQPSELATNKRLARECSDGSEHFVDAIMD
GGHFDYRFRPTDVQQLTVDEYWNNIILGLVGSTIPLCEFINGVRLVDKLSSRFPVLRIEV
WFKNLGEANDPTQLMKSIGACMARKLDGSVGTIPKGDLKWH
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggcagagtcagctagtgttgctgttaatggcacaaaaaagtgtccgtctttaactttt
aacaagaatacagaagaccatgctaaattatcagaattatttgaatctacgacaataaac
ctggatactcctttgtccttgaagaataaatgggtgatttgggagcagatagttaagatg
ccagaacactcccagaatgattataaagaacacacaaaaccattggtttcatttgattct
gtacaagccttttggaatttatggtttaatattcctcaaccgagtgaattagctaccaat
aaaagattggcacgtgaatgttccgacggttctgagcattttgttgacgccattatggac
ggaggtcatttcgattaccgtttcaggccaacagatgtacaacagctcacagtggacgag
tactggaataacattattttgggacttgtgggatcaacgattccactttgcgagtttatc
aatggcgttagactagtcgacaaactcagctcacgttttccagttctcagaatagaagtt
tggttcaaaaatttgggcgaagctaacgatcctactcaactcatgaaatctataggcgcc
tgtatggcaagaaaactggatggtagtgttggaacgatacctaagggtgatttaaaatgg
cattaa

DBGET integrated database retrieval system