KEGG   Theileria parva: TP03_0179Help
Entry
TP03_0179         CDS       T00254                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
tpv  Theileria parva
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tpv00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 444 aa AA seqDB search
MIRTEMAICTLVLIHIYTTLFITTAETFTKSDYEQKYNTKLEKLNADEVLHEPLKKFAYG
SCQRTYPQLRDIYNTILKYDPDIFFFTGDNFYTEMSCCDETCIERGYLKMANFPPFQEFK
KKIRKFDGVYDDHDYGINDGDATFKFKDFSQKIILDFFEKPEDHYRRKRKGVYFSMSYID
PENPKNHVKIIGLDLRYHRGCMYNCICELCGLTYVQSRLIMIRRLFNYMFGIGCKHDADA
LGEEQWKWLESQLVDSEATSHIIVSSFQVFTYRPMGESWGHFPNSKKRLLDLLEATKPKK
PIFLSGDVHFAELFEKHGLVEFTSSSLTHSVLPYNIYANILVYPFYLRVKNYTYRYNNFG
AIDFNYNHEDEGEKCLTYRSRNENLYDYVKEPDSVFVNHQLIKCLTKAELFVRILLYSPL
FVTPLLPFYFLFRMLLRFKKVKSK
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgattagaaccgagatggctatttgtactctagttttaatacatatctacacaacgctg
ttcattacgacggcagaaacattcacaaaatcagactatgagcaaaaatataacactaag
ctggaaaaattaaacgcagacgaagtacttcatgagcctctgaaaaaattcgcttacgga
agctgccaaagaacatatccacaactcagggatatatacaataccatactcaaatacgat
cctgacattttcttcttcactggagataatttttacacagaaatgagttgttgcgatgag
acgtgtatagaaagagggtacttgaagatggcaaacttcccaccttttcaagaatttaag
aagaaaatcaggaaattcgatggcgtgtacgatgatcacgattatggaataaatgatgga
gacgcaacatttaagtttaaagatttttctcagaagataatattagacttcttcgaaaag
cctgaggatcattatagaaggaagaggaaaggagtgtacttcagtatgtcgtatattgac
ccggaaaatccaaaaaatcatgttaaaattattggcctagatcttagataccacagaggc
tgtatgtataattgtatctgtgaactctgtggattaacctacgtacaatcgagattaatt
atgatacgtagactgtttaattatatgttcggaattggttgtaaacatgacgctgatgcg
ctgggcgaagagcaatggaaatggcttgaatcgcaactagttgactctgaggctacgtcc
catataatagtatcgtcatttcaagtatttacataccgcccaatgggtgaaagctggggg
catttcccaaactctaaaaagagattactagatttacttgaagcaacaaagccaaaaaaa
ccgattttcttatccggagacgttcattttgctgaactcttcgaaaaacatggacttgtt
gagttcacatccagtagtttaacacacagtgttttaccatacaacatttatgccaatatt
ctagtgtaccccttttatctcagggttaaaaactacacttacagatataacaacttcgga
gccatcgacttcaattataatcacgaagatgagggtgaaaaatgccttacttatcgcagt
agaaatgagaacctgtacgattatgtcaaagaaccagattccgtgttcgtaaaccatcaa
ctcataaagtgtttaaccaaagcggaactttttgttagaattttgttgtactcaccatta
ttcgtcacaccactgttacctttctatttcctgttcagaatgttgctccgattcaaaaaa
gttaaaagcaaataa

DBGET integrated database retrieval system