KEGG   Theileria parva: TP03_0419Help
Entry
TP03_0419         CDS       T00254                                 

Definition
protein disulfide isomerase (EC:5.3.4.1)
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
tpv  Theileria parva
Brite
Enzymes [BR:tpv01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     TP03_0419
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 538 aa AA seqDB search
MGNFKNILTSFVYLLILFPSGFFFSGSSLFCEAKNETDDVKVLTDDTFDKFLTENKLVMV
KFYADWCVHCKNLAPEYSKAAKMLKDEKSDVVFAKVRNEEGVNLMERFNVRGFPTLYFFK
NGTEVEYSGSRDAPGLVSWVKELSTPGVKFVEDPSVLPMDKVFVVSYSDYSLSDLDSGSV
SPLFLKFVRESDKYRSYFSFFNLAHTHKDKSSWNKWRTTEEWSKWKEFSQKHSDLKELTE
ALSKQEEEYKDKDMKEEYVVHQPSEGFTRFEGSTEDELEKFLSRETLPLFAEIDQENYMR
FITSGMDLVWFCGTKSDYDKYKDVFTKVARVLRHQSTFVWVDSDKFGTIKEVFLLTQLPA
VAYQTPTGRYLLQPNQQQSVKEAKSYNFDTFDSLLDFYHDVKMGLVPKSVRSEEEPKEND
GPVKVVVGNTLEKLFDSKKNVLLMIHAPHCQHCKNFLPVYTEFATVNKDNDSLIVASFNG
DANESSMEEVNWDSFPTLLYFKAGERVPVKFAGERTAEGLREFVTQNGGFVEDIHTEL
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggggaatttcaagaatatattgaccagtttcgtttatttattaattttattcccttct
gggttctttttctctggatcaagcctgttttgtgaagccaaaaatgaaaccgacgacgtc
aaagtcctcactgatgacactttcgataaattcctcaccgaaaataaattagttatggtc
aaattctacgctgactggtgtgtacattgtaagaatctggctccagagtattcaaaggca
gctaagatgctcaaggatgagaagtctgatgttgtcttcgccaaggtcaggaacgaagaa
ggtgtaaatctcatggaacgcttcaacgtcagagggtttccaactctctatttcttcaaa
aacggcacagaagttgaatattccggctccagagatgctcccggactggtatcgtgggtt
aaagaattgtcaacacctggagtcaagtttgtcgaagatccctcagtgttgccaatggac
aaagttttcgttgtctcctattcagattacagtttgtcagaccttgactctggatcagtc
tctcctcttttcctcaaattcgttagagagtctgacaagtaccgctcatacttttctttc
ttcaacctcgcacacacccataaggacaagagtagctggaacaagtggcgcacaactgaa
gagtggtcaaaatggaaggagttttcccaaaaacatagtgaccttaaggaactgaccgaa
gccttgagtaagcaggaagaggaatacaaggacaaggatatgaaggaagaatatgtggtc
caccagccttcagaaggattcacgagattcgagggaagcactgaagacgagcttgagaag
ttcctatcacgtgaaactctaccgctatttgctgaaattgaccaggaaaactacatgagg
ttcatcacctccggaatggatttggtctggttctgcggtacaaagtcagattatgacaag
tataaggatgtattcacaaaggtggctcgtgttctccgccaccaaagcacctttgtctgg
gttgactcagataagtttggaactataaaagaggtcttcttactcacccaactgccagca
gtggcttatcaaacacccaccggacgttatctcttacaaccaaatcaacaacaatctgtg
aaagaagcaaagtcgtacaattttgacacgtttgactcacttcttgacttctaccacgat
gtgaagatgggattagtaccaaaatcagtaagaagtgaagaggaaccgaaggaaaatgac
ggtccagtcaaggttgttgtcggaaacacccttgagaagctgtttgactcaaagaagaac
gttttgttgatgatccacgcgccgcactgccagcactgcaagaacttcctgcctgtgtac
acggagttcgcaactgtgaacaaggacaacgactcgctgattgtggccagcttcaacggt
gacgcaaacgagtcgagtatggaggaggtcaactgggactccttcccaactctgctctat
ttcaaggcaggcgaacgagttcccgtgaagttcgccggagaacgcactgctgaaggcctc
agggagtttgtcacgcaaaacggcgggttcgtcgaagatatccacactgaactataa

DBGET integrated database retrieval system