KEGG   Theileria parva: TP03_0480Help
Entry
TP03_0480         CDS       T00254                                 

Definition
clathrin heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
tpv  Theileria parva
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:tpv04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 1696 aa AA seqDB search
MSKNPIITQTILNLRELGFVEGNFKFDVLSLEGDRYVSIKEQDGDNLTVAIIDMYNNNTV
TRKPMKAEAAIMNPTQPIIALRAKLDNSYSVQVFNLENKEKLGYHQFDQKIIYWKWLSTS
ELVIITETHVYHWPVGSTPKLIFELTGKLLDTSTKIVGYSTDSTGKWCLVFGIYSNDQGV
SIDGIIQLYSVDKRQQQLFEGYAGTFGQLRTSNQTLKKTNLLIFCEHKKNTHNIKLHLMD
IGTLSNTNNSGSGNTGNPVSGNTVEILKINSLMERNEEYPNDFPISIHVLDSNGLILILT
KNGFAHFYYSTTLTLLFTSRISSMPLFVSCNKRLDGRSIGALAVNRAGEVISIIVDEDNL
LSSLSNLGLANLKEVSVGIATCYGLKGSDDLLLESFESFFNNEQYRQAAQIVATLKSNQL
RTLDTIQRFKNKTTETGNALSHYFSVLLESGRLNEIESIELVKPVILQNRKELLKKWLEN
DKLTESEPLADLLAQTDPSLAFQLYTKLNLHHKAINSLIQTNQIHNIIPYITKIISVNNE
FKGEFRGDLRDDLKGDKIVLNNLNINHIVESVATKQPNSLVSFVNSLISHKPGPLCDVTE
ITELLIRLNKLKELNEILLDYLKSNKKEHGELQTRLLEVNLKNDVRIAETILQLDILTQF
NKDHISNLCEQFELYEYSLKFYTKLQDIKRVVLKGINVLSRTTLNKTLLAMGEEDVLELL
RAMLENVQSELVVSSCLALYGKIDAMKLYQLLQDNPIAYQFLKSLPIIHSNTVDKDSNEL
VLRYISLCISKDEITELERLLLQNNNFNLSQAKELIKSSRLANPKPLMIICNRMGLVREL
VEHLYNNELREYIDVFVNSINPAAVSEVIATLLDLSASEQLINKVLATVRDPLLIKSIIN
ISEERHQLMMLKSFLESRVREGYKEEELHTALMKIYITTSQNPEQHLTDNNYYNKVVIAQ
YCEEIDVQLSILVYTVGGLDEQMIDLCLRHQLHKQLNQFLLKKSNLKLYQFFLQHSNVFE
DLISMCIENCNSNEISVLIKFLLSENLNNYLITLLEGLLLNQTEFSNNSNLQNLLLATTI
KTNPSKLSDYLSKLNNYEVNSLAKLANELHLHHCAYELYNKVNKHTEAFNELQLLLNTLG
DSVNNVHTGDSVNSVDTVDNVLEEMYSYVLRVDKELLWFKLGKIYLDHDKLQESIKCYLR
SNNFQHHQEIKQKLTQASEDDLLLHWLTESTKIKQLPELVNDLLIQLAKLGRAKEFTETL
NNTNTDLNLVGTELIKLNLYAEAVEIYSKMNNYNKLAVCYVQLSKYTEASEAALKSKNPK
ILKQTFDTLLSHLTQTDSTESVDLTARQMLNRLGSELLNYPEFLVSIVSSYESMGFFDDL
IELLRNTTKTVATSTELAICIAKYHPELLMEHLRNVAFESNSLNISKTARECSNLWLWKE
AVFLYTIDDSDKAILSMTLHPECFEQDLFFRTLNNVSNTEVIYKALYFCIQQYPTLVPKL
LLCVRSKLDTGRVIKILKNNNCIQLAKEYFQQYSDRNSQLVNDTLYELLVEECDFEQLEH
DVTKYINFDYVKLCALLEEHPLSRMRDVAAKIYLRHNHYSKASVIYMKNNNYIKAIDCAR
YSKSVQLVHDTVSNLLLRGEMNHLLVALVVNFHLLDLPEVLEMLWLNDVNMDLIIPLIIH
SQRFITHKKPLHLNNW
NT seq 5091 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaatccaatcataacccaaacaattctcaacttgcgtgagttgggatttgtt
gagggtaattttaagtttgatgttttatcacttgagggtgaccgttacgtaagtataaag
gagcaggacggcgataacttaaccgtcgccatcattgacatgtataataacaacaccgtc
actcggaaacccatgaaagctgaagccgccatcatgaatcccacacaacccattatcgct
ctcagagccaaactcgataattcctactctgtacaagtgttcaacttggagaacaaggag
aaattgggctatcaccagtttgaccaaaaaatcatttactggaaatggctatccacctct
gaacttgtaattattactgagacccacgtgtaccactggcccgtaggctcaactcccaaa
cttatcttcgaacttaccgggaaattactggacaccagtactaagattgttgggtactct
accgattccactggtaagtggtgcctggtatttggcatatattccaatgaccaaggtgtc
agtattgacgggataatacaattatactctgtagacaagagacagcagcagttatttgaa
ggctacgccggcactttcggacaactccgaacctccaaccagacactcaaaaaaacaaac
ctactcatcttctgcgaacataaaaaaaacacacacaacatcaaactacacctaatggac
attggcactctttcaaacacaaacaattcaggtagtggtaacacaggtaatcctgtgagt
ggtaacactgtggagatattgaagataaacagtttgatggagcggaatgaggagtatccg
aatgatttcccgatatcaattcatgtgctggactccaacgggttaatcctaatcctcacc
aaaaacggtttcgcacacttttactactccaccactctcacacttctcttcacttccaga
attagttcaatgccattgtttgtgagttgtaataagaggttggatggtaggagtattggt
gcattggctgtgaacagggctggtgaggtcattagtataattgttgacgaggataactta
ctgtcatcactcagcaatttggggctggccaatttaaaggaagtttcagttgggattgca
acttgttatggtcttaaaggttctgacgatttgctattagagtcgtttgaaagttttttc
aataatgaacagtacagacaagctgcacaaattgttgctaccctcaagtccaaccaactc
aggactctagacaccattcaaagatttaaaaataaaaccacagaaacgggtaatgcgttg
agtcactattttagtgtgttgttggagtctggtaggctgaatgagattgagagtatagag
ctggtaaagcctgtgattctccagaaccgtaaggagctgttaaaaaaatggcttgaaaat
gataaattaacggaatccgaaccgcttgctgacttactcgcacaaactgatccctcacta
gcgtttcaattgtacaccaaacttaacctacaccacaaagccatcaactccttaatccaa
accaatcaaatacataacattattccatacataaccaagattatttctgttaacaatgag
ttcaagggtgagttcaggggtgatctcagggatgacctaaagggtgacaaaattgtattg
aataatttgaatatcaatcacattgtggaatctgtagccacaaaacaaccgaattctcta
gtctcctttgtcaactctttaatatcacacaagcctggcccgctctgtgatgtcacagaa
atcacagagttgctcatcagactcaataaacttaaggagttgaatgaaatattgttggac
tatttgaagagtaataagaaggagcacggggaactgcagacgagattattagaggttaac
ttgaagaacgacgtccgaattgctgagactatactacaacttgacattctcacacagttc
aataaagaccacatctccaatctttgcgaacagtttgaactctacgaatattctctcaag
ttctatactaagctacaagatattaagcgtgtggtactcaagggaataaatgtgttgagt
aggacgacactgaataaaactttgttagccatgggagaggaggatgtgttggaattgctg
agggcgatgttggagaatgtgcagtcggagctggtggtgagtagttgtctggccttgtac
gggaaaatcgatgccatgaagttgtaccagctactgcaggataatcccattgcttaccag
tttctcaagtcactgccaataatacattccaatacagttgacaaggacagtaacgagttg
gtattgcgttacataagtttatgtatttctaaggatgagattacggagttggaacgtctc
ctcttacagaacaacaacttcaacctctcccaagctaaagaattaattaagtcatcacgt
ctggcaaatcccaaacccttgatgatcatttgtaaccgaatgggcttggtgagagaactg
gtggaacacctctataacaacgagttacgtgaatacattgacgtgtttgtgaatagtatt
aaccccgcagctgtttctgaagttatcgccacactgttggatctgtccgcctcagaacaa
ctgatcaacaaagtgttagccacagtcagagatccgctcctaatcaaatctattattaac
attagtgaagagagacaccagctgatgatgctgaagtcatttctagagtcaagagtgagg
gaaggatataaggaagaagagctccacaccgcactcatgaagatttacatcaccacatca
caaaaccccgaacaacatctcactgacaataattattataataaggttgtaatagcccag
tattgtgaggagattgatgtgcagttgagtattcttgtgtatacggttggtgggttggat
gagcagatgattgatctctgcctaagacatcagttacacaaacaacttaaccaatttctg
ctaaaaaagtcaaatctcaaactctatcaattcttcctacaacattcaaatgtgtttgag
gatctgatttcgatgtgtattgagaattgtaacagtaacgagatcagcgtgctgatcaaa
ttcctcttatcagaaaacttgaataattatctcatcacacttttggagggtttactactg
aatcagacagaattctccaacaatagtaacttgcaaaatctcctcctcgccactacaatt
aagactaatccctctaaactctctgattacttgagtaaattgaacaattatgaagtgaac
tcactggctaaattagccaatgagctacatctacaccactgcgcatacgaactctacaac
aaagttaacaaacacaccgaagccttcaacgaactacagttactactgaatactctaggt
gatagtgtaaataatgtacacactggtgacagtgtaaatagtgttgacacagtggacaat
gtgttagaggagatgtattcttacgttctaagggtggacaaggagttgctatggtttaag
ctgggaaaaatatacttggaccatgacaaattacaggaaagtatcaagtgttacctcagg
agcaacaacttccaacaccaccaggagattaaacagaagctaactcaggcttcagaggat
gatttactgctccactggctgacggaaagcacaaagataaaacagttaccagaacttgtg
aatgatttgttaatacagttggccaagttgggccgtgctaaggaatttacagagactcta
aacaacaccaacactgatctaaatctcgtgggcacagaactgattaaactgaatctctat
gcggaagcggttgaaatctactcgaaaatgaataattataacaagctggcagtttgctac
gtacagctgagtaaatacaccgaagcgtccgaagccgcactcaagtccaaaaaccccaaa
atactcaaacaaactttcgatacacttctctcacatctcacacaaactgatagtacggaa
tctgttgatttgactgcccgtcagatgttgaacaggttgggcagtgagttgttgaattat
cccgagttcttagtgagtatcgtgagtagttacgagagcatgggcttctttgacgactta
attgagttactgaggaacaccaccaagaccgtagccacctctacagagttggcaatttgc
atcgccaaatatcacccagagctcctaatggagcatttaaggaacgtggcctttgaatct
aactcacttaacatctccaaaactgccagagaatgcagtaacctatggctctggaaagag
gctgtgttcctctacaccatagatgactcagacaaggcaatcctctccatgacgttgcat
ccagagtgttttgaacaggacctcttcttccgcacactgaacaatgttagcaatacggaa
gtcatttacaaggctttgtacttttgtattcagcagtacccgacactcgtgcccaaactc
ttactctgtgtccggagcaaacttgacaccgggcgtgtcattaaaatacttaaaaataac
aactgcatacagttggccaaggagtattttcaacaatattccgatagaaattcccaatta
gttaacgacacactctacgaactcctggtggaagagtgtgactttgagcagttggagcac
gatgtaacaaagtatatcaactttgactatgtgaagttgtgtgcgctgttggaggaacac
ccgctctcacggatgcgcgacgtagcagcaaaaatatacctgagacacaaccactactcc
aaggcctcggtaatctacatgaagaataataattacataaaggccatagactgcgcgagg
tattcaaagtcagtccagctcgtccacgacaccgtgagtaacctgctgctcaggggcgag
atgaaccacttgctcgtggcactggtggttaattttcacctgctggacctcccagaagtg
ctggaaatgctgtggctaaacgatgttaatatggatttaataatcccactgataatacac
tcccagagattcatcacccacaagaaaccacttcacctcaataattggtaa

DBGET integrated database retrieval system