KEGG   Theileria parva: TP03_0494Help
Entry
TP03_0494         CDS       T00254                                 

Definition
ubiquitin carboxyl-terminal hydrolase (EC:3.1.2.15)
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
tpv  Theileria parva
Brite
Enzymes [BR:tpv01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     TP03_0494
Peptidases [BR:tpv01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TP03_0494
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 1062 aa AA seqDB search
MDQSSDSSEGVIPPPVPNETELVVKNFRDNVIGRLSMLIQRGESLEKIKEQYSVGIYSEW
KELPNFVFRIMLFPVCPHTEDSSSLNHLKISAYIEAAKRPDWPENWICYGTRFTIILINF
SEPHSSIFKRDSFNFSRVETDRGWQGFISLAQILENGFLNRDGDLVIRAGVYPTGPELDR
SARDPHYNSRAATGFVGLQNHGATCYMNALLQSLYSITKFRKSVYSLNFDLNTLIGQKSF
QIIQKYANSVNFEDVAATLEDDKVDLDNADLQSDKVELDDKVELDSLKVELEEEKIDLDT
PNAELPDDKIELDNGATEVPSEKIDLDSDKVELDDKLELDDKVEEKMDLDNPYPESNLPT
VRPLDYSYIYGFDLNWDEVLDELEEKDYCNLILEEEAERRKAPSLSLALQNLFYLLNYSD
TPPACKELMKSFGWDSSDMFTQQDSHELLKLLLDKMEEQMKGTPVEGSVKNIFEGEMETY
IECIDIDYKSCRKETFEDIQLDVQDCENIYESLDKLTAPELLAGENMYEAKGHGKQRANK
GIRFLKFPPVVIFLLKRFTFDLSRMDTVKLNNRFEFYKEISLSKYIQHDPTNTEDVDGDY
VLQAVSVHHGSINSGHYYAFAKNEDNWYRFDDELVTKVSEYAAINDNFGGEDQDCYNYFT
TNPSNPSIYSNHMNRYRRSKVYNAYILIYVLKSKKDEILGEVDMLKENYQMLSRYRIQRL
LHCLRSKTRERLNSFVKVKVFTPEDFEGNILLNQHFNTWPTKLVLKHDRFISLANLFSQI
NSIHADSAGMETNDAENHVDTGLDEDLCVNYYVLGLNKQFNKFLSIGDLKYKHKISVETI
SDLVQLLRREYYQQFDPTLYLLKTSSSAVDSQEAFSPKSSSSGIFTPTINISSTSLMQRS
ASLLGSAGLLRPSTPPDEKTFIVIKYYDIFTKDYENNLKCLKMVHINPQRTVSQLVPVVV
QQLIHFMSNDVVTPYRLKDLNKLLESINSGRPVSEDNLANTSFESITVESPPKSDTEDTN
GSPPNSDPNSLTDVELSSVNRTNNNSTVTSKLTLDYIVNITH
NT seq 3189 nt NT seq  +upstreamnt  +downstreamnt
atggaccagtcttcagattcctccgagggtgtgattcctcctcccgtccctaacgagaca
gagttagtagtaaagaacttcagagacaacgttataggacgcttgtcgatgttaattcag
cgaggagagtcgctagagaagataaaggagcagtactctgtgggcatatattcagagtgg
aaagagcttccgaactttgtgttcaggataatgttatttcccgtatgtccacatactgaa
gattcctcgagtctgaaccacctgaagataagtgcctacattgaggcggcaaagaggcct
gactggcctgaaaactggatctgttacggcactcgcttcactataattcttattaacttt
tctgaaccacactcgtcaatttttaagcgtgatagctttaatttttccagggttgaaact
gaccgaggctggcagggattcatttccctagctcagattttagagaatggattcctgaac
agagacggtgacctagttattagggccggagtttatcccacaggtcctgaactcgaccgt
tcagcacgggatccacactacaattccagggcagcaacgggtttcgttggacttcaaaac
cacggcgccacatgctacatgaacgctcttttacagagtctatacagtattaccaagttt
agaaagtcagtttacagccttaactttgatctcaacaccttaatcggacagaaatcattc
cagattattcaaaaatacgccaatagtgtcaatttcgaggatgttgctgccactctggag
gatgacaaagttgatttagataacgccgatttacagagtgataaagttgagttagacgat
aaagtggagttagattctcttaaagtggagttggaggaagaaaaaattgacttagatacc
cctaacgctgagttaccggacgataaaattgaactggacaatggggccaccgaggtaccg
agtgaaaaaattgacttagacagtgacaaagtcgagttagacgataaacttgagttagat
gataaagtggaggagaagatggatttggataatccataccctgagagtaatttaccaaca
gttaggccattggattattcatacatttatggatttgacttgaactgggatgaggtgttg
gatgagctggaggagaaggattactgtaatttaatattagaggaggaggctgagagaagg
aaggctccatctttgagtctagcattacagaatttgttttacctgttaaactactctgac
actccgccagcctgtaaggagttgatgaagtcgtttggctgggacagctcagacatgttc
acgcaacaggacagtcacgagctactgaaattactgttagataagatggaggagcagatg
aagggcacacccgtcgaaggaagtgtaaagaacattttcgagggtgagatggagacttat
attgagtgtattgacattgattacaagtcttgtcgtaaggagacattcgaggacatccaa
cttgatgtccaggactgtgaaaacatctacgaatcacttgacaagcttacagcgccagaa
ctcctagcaggcgagaacatgtacgaggctaaggggcatggaaagcaaagagccaacaag
ggcataagattcctcaagttccccccagttgtcatattccttctcaagaggttcactttt
gacttgagtagaatggataccgtcaaattgaataatcgcttcgagttctacaaagagatc
tcactgtcaaaatacatacaacacgatcccaccaacaccgaagatgttgatggcgattat
gtattgcaggctgtgtcggtgcatcacggatctataaatagcggtcactactatgcgttt
gcaaagaatgaagacaattggtacagatttgacgacgagcttgtgactaaggtatcagaa
tacgcagcgataaacgataactttggcggcgaggaccaggattgttataactactttaca
actaacccgagtaacccgagcatctacagtaaccacatgaaccgttacagaagaagtaaa
gtgtacaacgcctacatcttaatctacgtgctaaagagtaagaaggatgagattctgggc
gaggttgacatgttaaaggagaactaccagatgctaagtcgctatagaatacaaagacta
ttacactgtttacgctctaaaacaagagaaaggttgaatagttttgtcaaggttaaggta
tttacgcctgaagactttgaaggtaatatattactcaaccaacacttcaatacttggccc
actaaacttgtactcaaacacgacaggttcatctcactggcaaacttgttctctcaaatc
aattctatccacgcggatagtgccggcatggaaaccaacgatgcggaaaatcacgtggac
accggcttagacgaagatttatgtgtaaattattatgtcctagggttaaataagcagttt
aataagttcctgagtatcggcgacttgaaatacaaacataaaatatccgtcgagactata
tcagatttggtccagcttcttaggagagagtattaccagcagtttgacccaacgctttat
ttgctgaaaacgagttcctctgcagttgactctcaagaggcttttagccccaagagcagt
tcgagtgggatttttacaccaacaattaacatcagttcgacaagtttgatgcaacgttca
gcttctcttttgggttctgcaggactacttaggccatccacaccaccagacgagaaaacc
ttcatagtcatcaagtattacgacattttcacgaaggactatgagaataatcttaaatgc
ctgaaaatggtacatatcaacccgcagagaactgtgtcacagcttgtgccagtggtggtc
caacagctgatccacttcatgtcaaatgacgttgtgacgccctacagattaaaggacctt
aataagctattggagagtattaactctggaagaccagtgtccgaggataacttggcaaac
acgtcatttgagagtatcacagtggaaagtccacccaagtctgatactgaagataccaat
ggatctcctccaaacagtgatcccaactccctaacagatgtagaactgtcaagtgtcaac
agaaccaacaacaattccacagttacttccaagttaacccttgactatatagttaatatt
acacactaa

DBGET integrated database retrieval system