KEGG   Theileria parva: TP03_0511Help
Entry
TP03_0511         CDS       T00254                                 

Definition
cGMP-dependent protein kinase (EC:2.7.1.37)
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
tpv  Theileria parva
Brite
Enzymes [BR:tpv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     TP03_0511
Protein kinases [BR:tpv01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   TP03_0511
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 892 aa AA seqDB search
MSNKIDELTASFKNLANTFANRSMSKDKNPTIRKQRSKFIKKANESESYEDTEIVKHLVK
REKSESDKSFIKKSLANNVIFSALNDLEMSAFVDSMSYYVFSVGSKVTEQGTNGSYFFVI
NEGIFDVYIDGKLVNTMERGTAFGEISLINDTPRTATVKVRGVTENVKASSDTLGSLWGV
NRTVFRETLKNISMEVYSQNRSFLDSVKIFEMLTENQKNMVTNAFVESKFVPGDRIVTQG
DFGDVLYIIKEGKADVLINDEKVRTLTNGQYFGERALLYDEPRSATIVATEDTVCVSLGR
EILNKVLGNLDNVLFRNVMMEYLQNSTVFRQFTPDQLAKLIESASVRDFKPGDVILHREE
KIKGIRFFILLEGSVQILYEDNEIGIMERGDSFGEEYVLSPEIPFAHTVKCIINDKRAEG
SCKLALLTKHAIQEILGTDLIDEKLDYNNKLSVIKKMYIFRYLSEAHLDMLIKKFKSKRY
KKGEYIIREGEVGDSFYIISKGDVDIIKSGTRLRTLGKNDYFGERALLYDEPRTASVVCS
SANSDLWVVEKSVFLKIVEDPMLSHLENRIRVQDTKVLFDDLHTVRQIGKGIKLSNTISS
GTFGTVNLVVHQPSQLRFALKCVSKKLIVYNKQQKNIKMEKEIMAQNDHPFIIQLVKTFK
DEENIYFLTELVTGGELFDALRKLELLKKPQAQFYLGSIILALEYLHERQIIYRDLKPEN
VMLDHQGYIKLIDFGSAKKIEGRTFTVIGTPQYMAPEVIMGKGYNCMADIWSIGVCLYEF
ICGPLPFGDDAVDQFDVFKKFPDFLRDQDGINLIKRLLCRKTELRIGNSINGFKDIKEHP
YFRDFDWDSLACRGLKPPLIPEEENYNEEVCFVSFNTCISLTTNSRRFRNKI
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaataaaattgatgaattgacggctagtttcaaaaatctggccaacacattcgcc
aataggtccatgagcaaggacaaaaatcctaccatcaggaaacagagatctaaatttata
aaaaaagccaatgaatcagaatcgtacgaggatacggaaattgtgaagcatcttgtaaag
cgcgaaaagagcgaatctgacaaatccttcataaaaaagtcactcgcaaacaatgtaatc
ttctctgccctgaatgatctcgaaatgtcggcttttgtggactcaatgtcctactacgtc
ttctcagtaggctcaaaagttacggaacaaggcacaaacggctcatatttcttcgttatc
aatgagggtatctttgatgtgtacattgatgggaagcttgtaaacaccatggaacgagga
acagcttttggagaaatttccctgataaatgacacaccgcgaacagcaacagtaaaggta
agaggagtaactgaaaatgtaaaggcctcgagtgatacgctgggctctctttggggagta
aaccgcactgtgttcagggaaaccctaaagaacatttccatggaagtttattcccaaaat
aggtcatttttggactcagtgaagatttttgaaatgttgacagagaaccagaaaaacatg
gtaaccaacgcatttgtggaatccaaattcgtaccaggagacaggattgtaacccaggga
gattttggtgatgttctgtacataataaaggagggaaaagcagacgttttaataaatgac
gaaaaggtgagaacactaacaaatggtcaatatttcggagaaagagctttgctctatgat
gaaccgaggagtgcaaccatagttgcaacagaggacacggtctgtgtttcactaggccgt
gagattttaaacaaagtcttaggtaatctggataacgttttgttcagaaacgtgatgatg
gaatatttacaaaactcaacagtgtttagacagttcacaccagatcaattggctaaactg
atagaatctgcaagtgtgcgagactttaaaccaggcgacgtgattttacatagagaagag
aagatcaaggggatcagattcttcatactcctggagggatcagttcaaatcctgtatgag
gataacgagattgggataatggagagaggagactctttcggggaagaatacgtgttatca
cctgaaataccctttgcccacacagtcaagtgtatcattaacgataaaagagcggaaggg
agctgtaaattagcactcctaactaagcacgcaattcaggagattttaggcactgatttg
attgacgagaagcttgattataacaataaattgtctgtaataaagaagatgtatatcttc
agatacttgtcagaagcccaccttgatatgctcataaaaaaattcaagagtaaaaggtac
aaaaagggcgaatatataataagagaaggtgaagttggagatagtttttacattataagt
aagggagacgtagacataataaagtctggaacacgcttaagaacactgggcaagaatgat
tactttggagaaagagcgcttttgtacgatgagcccagaacagcatcagtggtatgctct
tcagcaaactcggacctttgggtggtggaaaaatctgtattcctcaagattgtcgaggat
cctatgttgtcacatctagagaacagaatccgtgttcaggatactaaagtcttatttgac
gatttacatacagttagacaaataggaaaaggtattaaactcagtaatacaatttcttca
ggcacctttggaaccgtaaacttggtagttcaccagccgagccaacttagatttgcactc
aaatgtgttagtaaaaagctcattgtctataacaaacaacaaaaaaatattaaaatggag
aaggaaattatggcccaaaatgatcatccattcatcatacaacttgtaaaaacgtttaag
gatgaagaaaatatatattttcttactgaacttgtaactgggggagaactgtttgacgcc
ttaaggaagcttgagttgttgaaaaagccgcaagcacagttttacctaggatcaatcata
ctggcactagaatacttacatgaacgccaaattatatacagggatttgaagcctgagaat
gtgatgttggatcatcaggggtatattaagctgattgactttggctctgctaaaaaaata
gagggaagaacgtttacggtgattggaacgccacagtacatggcacctgaagttataatg
ggcaagggatataactgcatggctgatatttggagtattggagtatgcctatacgaattt
atatgcggaccacttccatttggagatgatgctgtagaccagtttgacgtgttcaagaaa
tttccagatttcttgagagatcaggatggaataaacctgatcaagagactactttgtaga
aaaacagaacttagaataggaaactccataaacggattcaaagatatcaaagaacatcca
tacttcagagatttcgattgggactcgttggcgtgtagaggtttgaaaccgccgttgatt
ccagaagaggaaaactataacgaagaggtttgttttgtaagctttaacacatgtattagt
ttgacgacgaacagccgaagatttcggaacaagatttag

DBGET integrated database retrieval system