KEGG   Theileria parva: TP03_0675Help
Entry
TP03_0675         CDS       T00254                                 

Definition
hypothetical protein
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.1.2.15]
Organism
tpv  Theileria parva
Brite
Enzymes [BR:tpv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     TP03_0675
Peptidases [BR:tpv01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TP03_0675
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 1229 aa AA seqDB search
MDNNRSQAFHPSHENPDNQQKKHLFSNRINLPENYTGMDNYLNGENTNTYILERSTKLWN
HINTRPYSVNNYTSKYISKQILEERAAFDPYEEYVHKVVGDDKSDSREDKIETISDIFSE
TEDNVSILNKLHSLSLKTSTASLEQSKLKKAVQDQTNNTPLEQNDNSEIINSNQDQGEKI
YEVKDDKVLDPLNSVEKLEDKPNYQVTAVNNVLSGTQTELNSVTTTDTVKFHSDIIHTVD
HLNKMKIVEPIKEIPVGDSLNTGLTPTLSENNPFDLQNIGAKRIPSKNEVYRDRKLFNTS
TYLNNDATRDYGRSYAYRYGTEFTNFHTSNTINYSNYIDYNPFSVFSVKENSGNEVVKET
DLKKLRSIILSSSHSEETLIKYFTEAICITNTHMMNQIIHFLVTFLRETHKVRQFVVRLM
LCALSFHPEEFVSLFKVDYLSALFTPVIDDSIGVYFLKLLLSYKSTFGSRSEISTLVPYS
INSQGHLMYSSGQEPISTLRDSCMSGKIETLYILKILLERTKVSSVFNLPNSMLREQLCM
LWYDMPKTIPNVNIMEVLLHWINSKEDLETKKYPFMLLEKVRDLYPFPNGQMVLLSQFFL
FALNHKANVNNHLEYVITIASSEASPHESTNVSNRNSIRRESIMSSRNSYRNSGRNSSMD
FTRDEDILETVLYKILYNFTERDLLDLWCLVCVIPWKVTSPSSPFSRLFVSTLNTILKLT
SMSYDNHLMSGETKIRLDIMENCLRICLARCSCPINSLNSLLQTTLLLNPESHRNQPMQN
TAQLPSDNIIVATLYKNGMILNSLCNFLWKCHFLWTRIKEGVNMEIVIVVTELYKILGNF
TTLKPLDDTHLYTSASSANSGELYKFFNDSANKGLWTKITTFIPQMNLDQYFNTREMDEQ
EHYYEDMEEEPNYDTFNELGRDDYMVYSEDDFIDTGQVIGLKNLGNSCYLNSLLQSLCHT
KLFIYNLLKFRETNNSNKMVNSLVKLFRKMKTTGKRSISPKNVFKMVSENLTSSQQDVTE
AIRLISEAIDPDLELWKSVFAGLVVRRIKCLRCESFSDNEETIYDFSLSLNKAKSVQQML
DNFSKVEVLSGDNKYFCINCNKDVKAHMWNIIASPPSHLIIILNRNNWSYNETQKVLKAV
KIDSQLFIEGFQYRLYGSIIHSGDSTNSGHYYFIGCDSETFENWNKVDDSVVKPVHEFAV
DDLSRDPSNTHVPYVLFYRCLQAPQTPKF
NT seq 3690 nt NT seq  +upstreamnt  +downstreamnt
atggataataataggagtcaagcctttcatccctcccacgagaatccagataaccagcaa
aagaaacatctgttttccaacagaataaacttaccagaaaactacacgggtatggataat
tatttgaatggagaaaatacaaatacatacatacttgaaaggtcaaccaagctctggaat
catataaacacgaggccctattcagtaaataactacacgtcaaaatatatatcaaaacaa
attctagaagaaagagcagcattcgacccctatgaagaatatgtacataaggtagttgga
gatgataaatccgattctcgtgaagataaaattgaaacaatcagtgacattttttcagag
actgaagataatgtttcaatactaaacaaattacatagtctgagcctgaagacatcaacc
gcatctttggagcaatcaaaactaaagaaagcagttcaggatcaaacaaataatacacct
cttgaacagaatgataattctgaaatcatcaattctaatcaagaccagggagaaaaaata
tatgaggttaaagatgataaggttttagacccattgaattcagtagaaaaattagaagat
aagccgaattatcaagttaccgcagtaaacaatgttttgagtggaactcaaactgagttg
aattcagtaacaacaactgatactgtaaaattccactccgacataatacataccgtggat
catttaaataagatgaagatcgttgaaccaattaaagagataccagttggagatagtttg
aatacaggactgacaccaactttgtcagaaaataacccttttgatttacaaaacataggc
gcaaagagaattccaagtaaaaatgaagtttatagagatagaaaattgttcaatacatca
acatacttaaataatgatgcaacaagagattatggcaggagttatgcttatcgctatggt
actgagtttacaaactttcatacgtcaaacacgatcaactacagtaattacattgactat
aaccccttttcggttttctcagttaaggaaaatagtggaaacgaggtggtaaaggagact
gacttgaagaaactcagatcaataatactgagcagtagccacagtgaagagacgttaata
aagtactttacagaggcaatatgtataacaaacacacatatgatgaaccagattatccac
ttcttagttacatttctgagagaaacacacaaggtgagacagtttgtggttagattgatg
ttatgcgcactctcatttcacccagaagagtttgttagcctgtttaaggtggactattta
agcgcactgttcacaccagtgatagacgattcaataggagtgtatttcctgaagttgttg
ctttcatacaagtcaacatttggttcaaggtctgagatatcaactctcgtaccatactca
ataaactctcaaggccacttgatgtattcaagtggacaggagccgattagtacactaaga
gatagttgtatgtcaggtaaaatagaaactttgtacattttaaagatattgctggaacga
acaaaagtgtcgagtgtgttcaacctcccaaacagcatgctgagggaacagttgtgcatg
ctgtggtatgatatgcccaaaacaataccaaatgttaatataatggaagtgctgcttcac
tggataaactcgaaagaggatttggagacaaagaagtacccgttcatgttgttggaaaag
gtaagggacttgtatccattcccgaatggtcagatggttctactttcccaattcttcttg
tttgcactgaaccacaaggcaaacgtgaataatcacttggagtacgttattaccatcgca
agcagtgaggcaagtcctcacgaaagtactaatgtgtcaaacaggaacagcattagaaga
gaaagcataatgtcgtcgagaaatagttacaggaatagtggaagaaacagttccatggat
tttaccagagacgaggatattctggaaactgtgctgtacaagatactgtacaacttcaca
gagagagatctgttggatttgtggtgcctagtgtgtgttataccatggaaggtgacaagt
ccaagctcaccattctcaagattattcgtgtccacacttaatacaatactgaaactgacc
tcaatgagttatgataatcacttaatgtctggtgaaacaaagatcaggctagatataatg
gaaaactgtttaagaatatgcttggcaaggtgttcatgcccaataaactcactaaactca
ctgttgcagacaacgttactcctaaacccagagtcgcatcgcaatcaacctatgcaaaac
acagcccaactgccctctgataatatcatagttgctacattgtataaaaacggaatgatt
ttgaatagcctgtgtaattttttgtggaagtgccactttctgtggacaagaataaaggag
ggagtgaatatggaaatagtaattgtggtgactgagctgtataagatactgggaaatttc
acaacattaaagcctctggatgatacgcacctgtatacttcagcctctagtgcaaacagc
ggagagttgtacaagttctttaacgactcggcaaataaggggctttggactaagataacg
acgttcataccacagatgaatttggatcagtattttaacactagagaaatggatgaacaa
gaacattattacgaggatatggaagaagagccaaattatgacacatttaacgaattaggt
cgggatgattacatggtttacagtgaggatgattttattgatacaggtcaggtgatagga
ttgaaaaacctgggaaacagttgttacctaaacagtctactccagagtctgtgccacacg
aagttgtttatatataacctattgaagttcagagaaactaataatagtaacaagatggtc
aactcactggtgaagctgtttaggaagatgaagacgacaggcaagaggtcaatatcaccc
aagaacgtgtttaaaatggtttcagaaaacttgacaagctctcagcaggatgtaacagag
gctataaggttaatttcagaagctattgacccggatctagagctttggaagtcagtgttt
gcaggattagtggttaggagaataaagtgcctgaggtgtgaatccttctcagataatgag
gagacaatatatgacttctcattaagcttaaacaaggcaaaatcggtccagcaaatgctt
gacaacttctctaaggtagaggtgctttcgggagataataaatacttctgcatcaactgt
aataaggatgttaaggcgcacatgtggaacattatagcctcacctccatcacaccttatc
atcatactaaatcgcaataactggagctacaacgagacgcagaaggtcctgaaagctgta
aaaatagattctcagctgtttattgagggattccagtacagactctacgggtcaataata
cactcgggagactcgactaactcaggccactactactttattggctgtgattcggaaaca
tttgaaaattggaataaagtggatgactcggtagtaaaaccagtgcacgaatttgctgtg
gacgacctatccagagatccgtcaaacacacatgtgccctacgtgctattctacagatgt
ttgcaggcgccacaaacacctaaattttaa

DBGET integrated database retrieval system