KEGG   Theileria parva: TP04_0071Help
Entry
TP04_0071         CDS       T00254                                 

Definition
(RefSeq) histone H2B
  KO
K11252  histone H2B
Organism
tpv  Theileria parva
Brite
Chromosome and associated proteins [BR:tpv03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    TP04_0071
Exosome [BR:tpv04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   TP04_0071
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone TFIID_20kDa CBFD_NFYB_HMF YscO-like
Motif
Other DBs
NCBI-GeneID: 3500851
NCBI-ProteinID: XP_763706
UniProt: Q4N3B6
Position
4
AA seq 123 aa AA seqDB search
MSGKVPSSKSHAAKKTAGKTLGVRYRRKKRVESFSLYIYKVLKQVHPETGVSKKSMSIMN
SFINDVFDRLALEATRLIRYNKKSTLSSREVQTAVRLLLPGELSKHAVSEGTKAVTKYTT
SGV
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgtctggaaaagtaccctcatcaaaatcccacgcggctaagaaaaccgctggaaaaacc
cttggagtaagataccgcaggaagaagcgtgttgagtctttttcactttacatatacaag
gtgttgaagcaggtgcacccggaaactggtgtgagtaagaagagcatgagcatcatgaac
tccttcatcaacgacgtcttcgaccgtctcgctctcgaggccaccaggctcatcaggtac
aacaagaagagcactctcagctctcgcgaagtccaaactgccgtcagactcctcctaccc
ggcgaactctcaaaacacgccgtctccgaaggcaccaaagccgtcactaaatacaccacc
tccggagtctaa

DBGET integrated database retrieval system