KEGG   Theileria parva: TP04_0268Help
Entry
TP04_0268         CDS       T00254                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
tpv  Theileria parva
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tpv00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    TP04_0268
Translation factors [BR:tpv03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    TP04_0268
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 731 aa AA seqDB search
MVKVSPSDLSQEELEIGLLDWVSDDDEEFDKSQLDRFYELDPPVTLDKSFKRTLMVLGLP
VVGPEKHDRLRDVVRKTITKELEKKGCEIQTPFVLEIPTDNSKQTRGLAFFTFGTPFEAN
MALKFINKFKLDSSHAFKAILLDNFDMIVSDDNKCVPPLKTFGFTREGIRDWWTMGERMR
DQFVIRYADKTEVYWFDSVHREPKLAYDGSRERAEGRRAWADQKVEWSPNGSYLAVYKWA
GIALYGGNNFELKIRFEHKNVKNIQFSPCEEYLLTWDGLKGEDRHERSICIWRVITGELL
RSFPTPLKSPKGGDFPHLLWNRTGKYIAMLNQFSEGSEVMVYRLPEMTLIEGPDGKPAPL
KYAAEKFDWSPQDDILSVVIPGSLDTPARLVLVEIPSRRELSSRNVYNVCEVAMHWHSKG
DCLCLRTTISKKTGKKGRKQFNQLEIFRLRERNIPVDTIQIQDATVKQLHWEEGGSKRFA
LIVKDEETRSHSIRFYKVSDVGATRDTVWTTTFDITSQLNHMQWSPAGNYFVLGGLGAEG
SLFFCALNDNDKVDVLYKDEHFMMNTIRWSSCGRYLATCVNVPMPQHNATTSDSFRYSAE
AGYCLWTFQGRLLFKDRKENFYSFDFRPHPTPLLKRSEIEKIKKNLKEYTKKYDLIDEKE
RKDYRDSYLQKRQSNLDAFKQLYSSLLQWYTSQDNYLEFKSGWDKFLNPLDWEVTDDVYQ
EVIDIKEEVFE
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atggttaaagttagtccgtcagatctcagtcaggaggaacttgaaattggactcttggac
tgggtttctgacgatgatgaagagtttgataaatcacaactagataggttttatgaacta
gatccgccagtcactctcgataaaagctttaaaagaaccttaatggttttgggattacca
gttgttggaccggaaaaacatgacagacttcgtgatgtagttcggaaaacaataaccaaa
gaactggagaaaaaaggatgtgagattcaaacgccgtttgtattggagataccaacggat
aacagtaagcagacgagagggttagcgttttttacgtttgggactccatttgaggcgaat
atggccttgaagttcataaacaagtttaaactcgactcatctcacgcctttaaggctatt
ttgttggacaacttcgacatgatcgtgagtgacgacaacaagtgtgtgcctccactaaag
acctttggctttacaagggagggtattagggactggtggactatgggagaacgcatgaga
gaccagtttgtgattaggtatgcagacaaaactgaggtgtactggttcgactcagtccac
agagaaccaaaattagcatacgacggctcaagagaaagagctgaaggtagaagagcgtgg
gcagatcagaaagttgagtggagtcccaacggctcctatttagcagtttacaagtgggca
ggaatagctctttacggtggaaataactttgagctgaaaataaggttcgagcataagaat
gtaaagaacatacaattctcaccttgtgaagagtatcttctcacctgggatgggttaaag
ggtgaggataggcatgaaaggtccatttgtatttggcgggttatcaccggtgaacttttg
aggagttttccaacacctttaaagtcaccaaaaggcggtgatttccctcatctcctttgg
aataggactggaaaatacattgcaatgttgaaccagttttcggagggcagtgaagtcatg
gtttacagactacctgagatgacactcattgaaggacctgatgggaaaccagcacctctc
aaatacgccgccgaaaaattcgattggtctcctcaagacgacatcctctccgtcgttatt
ccaggctctttagataccccagcgagattggtattggttgagattccttcaaggcgtgag
ttgagttcaaggaacgtgtacaacgtctgtgaagttgcaatgcactggcattcgaaaggc
gattgcctatgcctaaggacgacgatatcgaagaagactggaaagaagggcaggaagcag
tttaatcagcttgaaatattccgtctgagagaaagaaacataccagttgatacaatacaa
atacaagatgcaactgttaaacagttacactgggaagaaggcggaagtaagagatttgcg
ttgattgttaaggatgaggagacgagaagccactccatcagattttacaaggtctctgat
gtcggagctactagagacactgtctggacaacgacatttgatattacttcgcaattgaac
catatgcaatggtcaccagcgggaaattactttgttctgggcggattaggcgcagaaggc
tcactcttcttctgtgcattaaacgataacgacaaagtcgacgtgttgtataaggatgag
cattttatgatgaatacgataaggtggagtagttgtggaaggtacttggcaacatgtgtg
aatgtgccgatgcctcaacataacgccacaacttcagactcattcaggtatagtgcagag
gctggatattgtctgtggacgttccagggcagactactgtttaaggacaggaaggagaat
ttttacagcttcgacttcaggcctcacccaacacctttactcaagaggtcggaaattgaa
aagattaagaagaacctgaaggagtacaccaagaagtacgacctcatcgatgagaaagag
aggaaagattacagagactcatatttacagaaaagacaaagtaatctcgacgccttcaaa
caattatactcatcactcctacaatggtacacctcacaggataattatttggagttcaag
tcgggctgggataagtttttgaacccgttggactgggaagtgacggacgatgtatatcag
gaagtgatagacataaaggaggaagtttttgagtaa

DBGET integrated database retrieval system