KEGG   Theileria parva: TP04_0404Help
Entry
TP04_0404         CDS       T00254                                 

Definition
histone H2B-III
Orthology
K11252  
histone H2B
Organism
tpv  Theileria parva
Brite
Exosome [BR:tpv04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   TP04_0404
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 107 aa AA seqDB search
MVKKRVHKGKKKARSETYSTYIFKVLKQVHPDTGVSKKSMLVLNSFVTDTFEKLATEAGK
LCKYNKKETLSSREVQTAVRLVLPGELAKHAVSEGTKAVTKFTGKHH
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagaagcgtgtgcataagggtaagaagaaggctcgttcggagacttacagtact
tatatatttaaggtgctgaagcaggttcatccggatacgggtgtgtcaaagaagtcgatg
ttggtgcttaactcgtttgtgactgacactttcgagaagctcgccactgaggctggcaag
ctctgcaagtacaacaagaaggaaaccctcagctcccgcgaggttcaaaccgccgtcagg
ctcgtacttccaggcgaactcgccaaacacgccgtctcagaaggcaccaaagccgtcacc
aaattcacaggcaaacaccattaa

DBGET integrated database retrieval system