KEGG   Theileria parva: TP04_0504Help
Entry
TP04_0504         CDS       T00254                                 

Definition
dihydrofolate reductase-thymidylate synthase (EC:1.5.1.3)
Orthology
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
tpv  Theileria parva
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpv00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    TP04_0504
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TP04_0504
   00670 One carbon pool by folate
    TP04_0504
Enzymes [BR:tpv01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     TP04_0504
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.45  thymidylate synthase
     TP04_0504
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 522 aa AA seqDB search
MAEDYSGLPFVKLLVAITPENGIGISNGLPWPHIKRDFLFMFRATTYVDPEFKEKHPGAQ
NVIIIGRKTYDSLPEGTFPLKNRINVVISRNLTEVPGGLVFPSMPAAIRHVTEHLNYYKI
FIMGIFHLNIKHLGGSYVYRDALDARIVDKMYVTRVNKNYKCEVFFPKIPDDFVITGISK
TFSSEDTTYDFVTYERKDLIVDDRVKKTFEEMLLTGEKFATKDQLVKACPSLKVRYSQEL
QYLEILADILNTGYHKKNRTGVDCIAKFGYQMRFDLSESFPLLTTKKVFLRGIIEELIWF
IKGSTNGNELLKKNVRIWELNGARSFLDNLGFFDREEHDLGPVYGFQWRHFGAKYVDMHT
DYSNQGIDQLSLVIDRIKNNPDNRRLIVCSWNVADLSKMALPPCHLLFQFFVADGTLSCM
MHQRSCDMGLGVPFNIASYSLLTYMIAQICGLKPGEFVHNLGDAHIYNNHIDAIKEQISR
VPYPFPTLRLNKDITRIEDFTIDDIKVENYRSHPVIKMEMAA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagattactctggattacctttcgttaaattgttagtagcgataacgccagaa
aatggaattggaatcagtaatggactaccatggccacacatcaaaagggactttcttttt
atgttcagggcaacgacttatgttgatccagaattcaaagaaaagcacccaggagctcaa
aatgtaataatcattggtagaaagacatacgatagccttccagaaggaacttttccactg
aagaacagaatcaacgttgttatatcaagaaatcttactgaggttccaggtggattagta
tttccttcaatgccagctgcgattcgtcacgttactgaacatctcaactactataagatc
ttcataatgggtatttttcatctaaatataaaacatttaggaggaagctacgtctatagg
gatgctcttgatgcaagaattgttgataaaatgtacgttacaagggtaaacaagaattac
aagtgtgaagtgttcttcccaaagatccctgatgacttcgttataactggaattagtaaa
acgttctcaagtgaagacacaacatatgactttgtgacgtacgaaagaaaagatttaatt
gttgatgatcgcgttaaaaaaacatttgaagagatgttgttgactggagagaaatttgca
actaaggatcaattggtgaaagcttgcccatcactgaaggttagatacagccaggaactt
cagtatcttgaaattctagctgacatcttaaacactggatatcacaaaaagaatagaaca
ggcgtggattgtattgcaaaattcggttaccaaatgaggtttgacctttcagaatcattt
ccgttattaacaacaaagaaagtcttcttaagaggaatcattgaggagcttatttggttt
attaaaggtagcacaaacggcaatgaattgctgaaaaagaatgtaagaatctgggagctg
aatggagcaagaagttttctggataacctgggattttttgatcgcgaagaacatgaccta
ggacctgtttacggattccaatggcgtcatttcggtgccaaatacgtagatatgcacaca
gactacagtaaccaaggaattgaccagctatcactggtcattgataggatcaagaataac
ccagataacagaagattgattgtgtgttcgtggaacgtagcagacctgtcaaagatggca
ttgcctccatgtcatctgctattccaattttttgtagcagatggaacattgtcgtgtatg
atgcaccaaaggtcatgtgatatgggactaggagtaccatttaacattgcatcatactca
ttactgacctacatgatagcccaaatatgtggactaaaaccgggagaatttgtacacaac
cttggagatgcccacatatacaataaccatattgacgcaatcaaggaacagattagtaga
gttccttatccattcccaaccctaagactaaacaaagatataacaaggattgaagacttc
acaatcgatgacattaaggtggaaaattaccgttcacacccggtaatcaagatggagatg
gctgcataa

DBGET integrated database retrieval system