KEGG   Theileria parva: TP04_0508Help
Entry
TP04_0508         CDS       T00254                                 

Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
tpv  Theileria parva
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 532 aa AA seqDB search
MEKFTVMFHPCENLDNYLKNTYSFSPYYTHHFFHNDLNTSAIQWVRYDVYYIVDTYELFI
KVSGQLYMSKEDSEIRKSLYTIYNSIFSKIPEYTLILDESTFKHLLYMRSVGTQKFMPPG
RIIVEIPLDNSLIFQLRYCVFQEESNTPNNSPNGSANLKGFYKRTSSEDSYFPELTDKSI
YFKNTLEKDHFDIELYDECYINISHKGNFDNCLIYDIIKYINRSNGDRQKIPRKSTYDRL
NFAVQENFNILHRRLEWFYHWFIEGASNIKADSRWSVFIPMLIFTYDAFDDEYKNTTNSI
SNLLTCKEEFQKTILNRSTEMNSQSIRLKIMQQPVGTISDMVHCKNKRTHLSKKLNQSGN
QYNVSIIGMVTAYYFFTLNHDRLRISQFLIFPNYWGKGFGLWVLEFIYRMAIMDSNVREI
TVEDPTSAFLVLRYVVALKICFESKLLDPNILYANNKNGLGIFKIFTKESTIPSKDKICS
VCKESKACSSKLVEILQLASILPYPISTQNFVNRYTNKRQKTNDIGSTHDNN
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggagaagtttactgtgatgttccacccatgtgaaaacctcgacaattaccttaaaaac
acatactccttctctccatactacactcatcactttttccacaatgatttaaatacctcc
gcaatacaatgggtaagatacgacgtgtactatattgtcgacacatacgagttgttcata
aaggtttcgggtcagctgtacatgtcaaaggaagattctgaaatcaggaagtcactgtac
acgatatataactcgattttttcaaaaattccagaatacacactcatattagatgaatcc
acttttaaacacttattatatatgcgttcagtaggaacacaaaaatttatgcctccaggc
cgtatcattgttgagattcctctagataactcgttaattttccaactgagatactgtgta
tttcaagaagaatcaaacacacctaataattcacctaacggatcagcaaatttgaaaggt
ttttacaagagaacgtctagtgaagactcctacttcccagaactgacagataagtcaata
tattttaaaaacacacttgagaaagaccatttcgacattgagttatacgacgagtgttat
ataaacatctcacataagggcaattttgacaattgcctgatttatgatataatcaaatac
ataaacagatcgaatggcgataggcaaaaaatccctaggaaatcgacctatgatcgtctt
aattttgcagttcaggagaattttaacatactccataggagattagagtggttttatcac
tggtttatagaaggagcctctaatattaaggccgattcgaggtggtctgtttttatacca
atgcttatattcacgtatgacgcatttgatgatgagtacaagaatacaacaaactccata
tcaaatttactaacatgtaaggaagagttccagaaaactattttaaatagatcgaccgag
atgaattcgcaaagcattaggttaaaaatcatgcaacagccagtgggaacgatatcagat
atggtacattgtaagaacaaaaggacccacttatcgaaaaaattaaaccagtcaggaaac
caatataacgtgtcaataattggaatggttactgcatattatttttttacattgaaccac
gacagactaagaatatcacagttcttgatatttcctaattactggggaaaggggttcggt
ttgtgggtattggagtttatatatcggatggcaataatggattcaaatgtgagagaaata
accgttgaggatcccacttcagcttttctggttttgagatatgtggtggctcttaagata
tgtttcgagtcaaaactattggaccccaatatcctgtatgcaaacaacaaaaacggactt
ggaatatttaaaatatttacaaaagaatccacaatcccatcaaaagataaaatatgctca
gtatgtaaggagagcaaggcttgttcatcaaagctggtcgagattctacaactcgcatca
attctgccatatcctatttcaactcaaaattttgtaaatagatatacaaacaaaaggcag
aaaactaacgatataggtagcacacatgataataattga

DBGET integrated database retrieval system