KEGG   Theileria parva: TP04_0577Help
Entry
TP04_0577         CDS       T00254                                 

Definition
cyclin
Orthology
K06634  
cyclin H
Organism
tpv  Theileria parva
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:tpv00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    TP04_0577
  Replication and repair
   03420 Nucleotide excision repair
    TP04_0577
Transcription machinery [BR:tpv03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     TP04_0577
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 322 aa AA seqDB search
MEENCVCGIEFNSVKNSTHYKNWFIDSTQKLNSIQLNTYQHAAKLLKRGDGVRIPSFEEE
LWLIKYYSLQLSQFVNANNLKPSVKETSLVLFNRFYLRRSLLQYDPRIIMFTCITLATKL
EDMWRSVYIDKLLYKINNLNITKVFEMEAIVCDVLNFNLNILHLSDSIHILIQLLINYIR
ESLEVEGINEYIGVILYMFKQAEITSLIMVESPTLMFLYTPAQLALSVILQLVKSTSLST
ILSIESFVTTQLLNGDETYLMKLLSLTQSINRILWIYTLKFMKLPPSEIYCCLVVSVHVT
PTAVAKLCINCCRLLEEMLIIV
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggaagagaattgtgtgtgcggaattgagtttaattcagtcaagaattccacacattat
aaaaattggttcattgattccacacagaaactcaattccatacaactaaacacttaccaa
cacgccgccaaactcctcaaacgaggtgacggtgttaggattccgagttttgaggaggag
ttatggctcattaagtattactcacttcaactatcgcaattcgtaaacgccaataatctc
aaaccttcagttaaagaaacgtcattggtgttgtttaacaggttttatttgcgacgttca
ctgcttcaatacgatcccagaattatcatgtttacgtgtataacattggcaactaagctt
gaggacatgtggcgttcagtgtacattgacaagcttttatacaagattaataacctcaac
atcacaaaagtgtttgagatggaggcgatagtctgcgacgttttgaacttcaacctcaac
atcttacacctcagcgattccatccacattctcatacaacttctcatcaattatataagg
gagagtttggaggtggaaggcataaatgaatacattggcgttatcttatacatgtttaaa
caagctgaaattacctcactcatcatggtcgaatcacccacgttaatgtttttgtatacg
ccggcgcaattggcattatctgtaatcttacaacttgttaaatccacctcactttccacc
attctctccattgaatcttttgtgacaactcaattactaaatggagatgaaacttattta
atgaaactgctctcactcactcaatccatcaacagaatattatggatttatacgttaaaa
tttatgaaacttccacctagtgagatctactgctgtctggtggtgagtgttcatgttact
cctacagcggtagcaaaactctgcattaactgctgtagattactggaagaaatgttgata
attgtttag

DBGET integrated database retrieval system