KEGG   Theileria parva: TP04_0690Help
Entry
TP04_0690         CDS       T00254                                 

Definition
(RefSeq) phosphoglycerate mutase I
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
tpv  Theileria parva
Pathway
tpv00010  Glycolysis / Gluconeogenesis
tpv00260  Glycine, serine and threonine metabolism
tpv01100  Metabolic pathways
tpv01110  Biosynthesis of secondary metabolites
tpv01130  Biosynthesis of antibiotics
tpv01200  Carbon metabolism
tpv01230  Biosynthesis of amino acids
Module
tpv_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tpv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TP04_0690
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TP04_0690
Enzymes [BR:tpv01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     TP04_0690
Membrane trafficking [BR:tpv04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    TP04_0690
Exosome [BR:tpv04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   TP04_0690
  Exosomal proteins of melanoma cells
   TP04_0690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1 TAF6_C
Motif
Other DBs
NCBI-GeneID: 3500492
NCBI-ProteinID: XP_764326
UniProt: Q4N1P2
Position
4
AA seq 254 aa AA seqDB search
MYTLVLLRHGESVMNKANRFCGWIDVDLSEEGEKQARDAAELLRPFNFRFGHVYTSILKR
SYETARLVLETLNHPEVPMTKTWRLNERHYGALQGLDKEETAKKFGEAMVKVWRRSYDIR
PPPVDESSEHYPANNPVFDVVPREFLPNGESLKLTLERVMPFWEGEIVPELRKGKPVFVA
AHGNSLRGLIKMLDNMSEAEVLEFNLPTCVPVLYYLNEDLSVSSKKYLLDEESLKAKMDA
ESNVMKSGSKDKSA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtatacattagtccttttaaggcatggcgaaagcgttatgaacaaagctaaccgcttc
tgtggatggattgacgtagatctgagtgaggaaggagaaaaacaagccagagatgcagcg
gagcttctgagaccattcaattttagatttggtcatgtttacacttctatcctgaaacgt
tcatacgaaactgcaagattagtcctagagacgttaaatcaccctgaagtccccatgact
aaaacttggaggctcaacgaacgtcactatggcgcccttcaaggcttagacaaggaggaa
acggctaaaaagttcggagaggctatggtgaaggtttggagaagatcatacgacattagg
ccaccgccagttgacgaatcaagtgaacactatccagccaataatccagtgttcgatgtt
gttcccagggagttcttgccaaacggagaaagcctaaagctaacattggagagagttatg
ccattttgggaaggagagatagtgcctgaactcagaaagggcaagcctgtttttgttgct
gctcatggcaacagcctgagagggttgataaagatgctggataacatgagcgaagctgag
gttctggagtttaacctcccgacctgtgttccagtactctattatcttaatgaagactta
tctgtaagcagtaaaaagtaccttttagatgaggaatctctaaaggccaagatggatgct
gaaagcaatgtaatgaaaagcggatcgaaggataaaagcgcttga

DBGET integrated database retrieval system