KEGG   Theileria parva: TP04_0690Help
Entry
TP04_0690         CDS       T00254                                 

Definition
phosphoglycerate mutase I (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
tpv  Theileria parva
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:tpv01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tpv01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tpv00010]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:tpv00260]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 254 aa AA seqDB search
MYTLVLLRHGESVMNKANRFCGWIDVDLSEEGEKQARDAAELLRPFNFRFGHVYTSILKR
SYETARLVLETLNHPEVPMTKTWRLNERHYGALQGLDKEETAKKFGEAMVKVWRRSYDIR
PPPVDESSEHYPANNPVFDVVPREFLPNGESLKLTLERVMPFWEGEIVPELRKGKPVFVA
AHGNSLRGLIKMLDNMSEAEVLEFNLPTCVPVLYYLNEDLSVSSKKYLLDEESLKAKMDA
ESNVMKSGSKDKSA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtatacattagtccttttaaggcatggcgaaagcgttatgaacaaagctaaccgcttc
tgtggatggattgacgtagatctgagtgaggaaggagaaaaacaagccagagatgcagcg
gagcttctgagaccattcaattttagatttggtcatgtttacacttctatcctgaaacgt
tcatacgaaactgcaagattagtcctagagacgttaaatcaccctgaagtccccatgact
aaaacttggaggctcaacgaacgtcactatggcgcccttcaaggcttagacaaggaggaa
acggctaaaaagttcggagaggctatggtgaaggtttggagaagatcatacgacattagg
ccaccgccagttgacgaatcaagtgaacactatccagccaataatccagtgttcgatgtt
gttcccagggagttcttgccaaacggagaaagcctaaagctaacattggagagagttatg
ccattttgggaaggagagatagtgcctgaactcagaaagggcaagcctgtttttgttgct
gctcatggcaacagcctgagagggttgataaagatgctggataacatgagcgaagctgag
gttctggagtttaacctcccgacctgtgttccagtactctattatcttaatgaagactta
tctgtaagcagtaaaaagtaccttttagatgaggaatctctaaaggccaagatggatgct
gaaagcaatgtaatgaaaagcggatcgaaggataaaagcgcttga

DBGET integrated database retrieval system