KEGG   Theileria parva: TP04_0767Help
Entry
TP04_0767         CDS       T00254                                 

Definition
ubiquitin carboxyl-terminal hydrolase (EC:3.1.2.15)
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
tpv  Theileria parva
Brite
Enzymes [BR:tpv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     TP04_0767
Peptidases [BR:tpv01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TP04_0767
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 526 aa AA seqDB search
MENQDNTVSVNVKWMGKQYEGLKMSLDEPLESFKNQLCSLTGVPPERQKIMFKGIIPNDA
DLSKIKITNGARLMLIGSAEKPPECIEKVRFFEELSSQEKAKIMNDNIIVKLPPGIMNLG
NTCYFNSVVQFLFPVTELWNSVSKCLEVNGNSPDVHFAKSLLDMKNQLNHTLERFVPLVQ
IQFLRKINPLFCRKDEKTGMYMQQDAEECLNCILGNLNSLSEDKIAENVFGFSMVSKTKP
VKPEGSDSEPSETDTNPGENVSSVEHNLVLSCYMGTPLKSVGTLMDGINLSLNEELLKFS
EKDGCDVLHNKVSKLSSLPKYLIVHLVRFEWKQKSQVSHTDAIKAKVCRRVNFERYIDIT
SICSEELQQKLRAAKSHQIKKEDKLKEELNGQEKVENKNEGENLDVEMVNLDGYEISPGE
YATGKYELISIVTHQGRTADAGHYICWTKDSREYPTKNPSNSNEKDMDNQRDGEKESKKK
KQEDRWIKFDDDVVSEQDWGSFDLCGGRSDYHIAVLLLYKSQNTTL
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaccaagataatactgtgagtgttaacgtgaaatggatgggcaaacaatacgaa
ggcctgaaaatgagcttagatgagcctttagagtcttttaaaaaccaactttgttccctc
actggtgtgcctcccgaaaggcaaaagataatgtttaagggtataattccaaatgacgcc
gatttatcaaaaattaagattactaatggagctaggcttatgctaatagggagtgcggaa
aagccgcccgagtgtattgagaaagtccgtttctttgaggagctgtcatcacaggaaaag
gccaaaattatgaatgataacataattgttaaacttccaccgggcataatgaacctaggg
aatacgtgttattttaattcggtagttcaattcctattcccagttaccgaattgtggaat
tctgtttcaaagtgcttagaagtaaatggtaactcaccagacgtccattttgcaaagtca
ctacttgatatgaagaaccagttgaaccacacccttgagagatttgtccccctggttcag
atacaattcttgaggaaaataaatcctctgttttgtagaaaggatgagaaaacaggaatg
tatatgcaacaggacgcagaggaatgtttaaattgcatactgggaaacttaaactcttta
tctgaagataagattgcagagaatgtgtttggcttttccatggtctcaaaaacaaagcct
gttaagcctgagggttcagactccgaaccgtcggagacagacacaaatcccggggaaaat
gtcagttcagtggaacataatctggtgctatcctgctatatgggaactccactgaagtct
gttggaaccttaatggacgggattaacctgtcacttaacgaggagctgctaaagttttca
gagaaggatggctgtgacgttttgcataacaaggtcagcaagcttagttctctcccgaag
tacttgatcgtacatcttgtccgttttgagtggaagcagaagagccaagtatcgcataca
gacgcaattaaagccaaggtgtgtagaagggttaattttgagaggtatatcgatatcacg
agtatttgttctgaggaacttcaacaaaaactaagagctgctaaatcccaccaaattaag
aaggaagacaaattaaaggaagaattaaatggacaggaaaaggtagagaataagaatgag
ggcgaaaacctagatgttgagatggtaaatttggatggttacgaaatatcaccgggagaa
tatgctactggaaaatatgagcttatttctatagtaactcatcaaggaagaacagcggat
gcaggtcattacatatgttggaccaaggattcgagggaatacccgacgaaaaacccgtca
aacagtaatgaaaaagatatggataaccaaagggatggtgaaaaagaatctaaaaagaaa
aaacaagaagacaggtggatcaagttcgacgatgatgtggtctcagagcaggattgggga
tcatttgatttgtgcggaggcaggagtgattaccatattgctgtattactattgtataaa
tcacaaaatacaacactataa

DBGET integrated database retrieval system