KEGG   Treponema pallidum subsp. pallidum Nichols: TPANIC_0902Help
Entry
TPANIC_0902       CDS       T02709                                 

Definition
putative esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
tpw  Treponema pallidum subsp. pallidum Nichols
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(985606..986487)
Genome map
AA seq 293 aa AA seqDB search
MRPIVAAQRVTIQETRAVLAARFLFTFCCFFTTLARYLLMAEHTSCTSIHPLVRSAFYAG
GAHAVLLIHGYMGTPREMQFLGRALHRDGFTVSIPRLPGHGTNREDFLETGWRDWLRRVC
DEYRDLSAAYPSVSVGGLSMGGVLTALVAARFCPQKAFFCAPGFAVSDWRIKLSPLVRWF
VREFAADAAPFYPEQDFNDATKDYRSAHYIAQVAQFYALQRRAIRSLACIRSTLLTILSR
QDPLVPCAAVQKLLDARVRSAHQYVVLEHSGHVITDDVEREQVASCVSAFLRT
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgcggccgattgtagccgcgcaacgcgtgacaatacaagagacgcgtgcggtgctcgcg
gcacggtttctctttactttttgttgcttttttactaccctcgcgcgctatctgcttatg
gctgaacatacttcctgtacgagcattcatcctcttgtgcgcagcgcgttttacgccggg
ggtgcgcatgcagtactgcttattcatgggtacatgggcaccccgcgcgagatgcagttt
ttaggtcgtgcgctccaccgggacggctttacggtctctattccccgtttacctggtcac
ggtacgaatagagaggattttcttgagaccgggtggagggattggctgcggcgcgtgtgt
gatgagtaccgtgacctttccgctgcgtacccttcggtatctgtgggggggctgtccatg
ggaggtgtgctgactgcactcgtggcggcgcgtttttgtccccagaaagctttcttttgt
gcaccgggttttgcagtttctgattggaggataaagctgtctcctctagtcaggtggttt
gtgcgtgagtttgctgcggacgcggctcccttctaccccgagcaagactttaatgacgcc
acaaaggattaccggagtgcgcactacattgcccaggtggcgcagttttacgcactgcaa
agacgtgcgatccgttcgctggcgtgcattcggagtacgttgttaacgatcctgtctcgg
caggacccattggtgccgtgtgcagcggtgcaaaaattactcgatgcgcgtgtgcgcagc
gcacaccagtacgtagtgctcgagcacagtggtcacgtgatcactgatgacgtggagcgg
gagcaggttgcctcttgtgtcagtgcttttttacgcacgtag

DBGET integrated database retrieval system