KEGG   Turneriella parva: Turpa_0014Help
Entry
Turpa_0014        CDS       T02157                                 

Definition
acireductone dioxygenase apoprotein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
tpx  Turneriella parva
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:tpx00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pTURPA.01:14043..14582
Genome map
AA seq 179 aa AA seqDB search
MQSQLTICPEGNSSQKEVYSDFETIKKHLAAVGIGYERWVAEQPLAADASPEEVAKAYKT
SIDKIMQQGYKTYDVVSLHPDAPQASEARKKFIDEHTHGEDEVRFFVDGSGMFYIHKAGK
VFMMLCTKGDFINLPAGTTHWFDMGPKPFFKAIRVFNNPEGWVATFTGSDISQKFPKYE
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgcagagccagttaacgatttgccctgaaggcaattcatcacaaaaagaagtctattct
gatttcgagaccatcaagaaacaccttgcggctgttggcattggctatgagcgctgggtt
gcagagcagcctttggcggctgacgcttcgcccgaagaagttgcgaaggcctacaaaact
tcgatcgacaagatcatgcagcagggttacaaaacttatgacgtggtttcgctgcacccc
gatgcaccgcaggcaagtgaggcgcgtaaaaaatttatcgatgagcatacgcacggcgaa
gacgaggtgcgcttcttcgtcgatggttcaggcatgttttacattcacaaggccggcaag
gtcttcatgatgctctgtaccaagggagacttcatcaatttgcctgcaggtacaacgcac
tggttcgacatgggcccaaagcccttttttaaggcgattcgtgtttttaacaaccccgaa
ggctgggtggcgacatttacgggcagcgatatttcgcagaagtttccgaaatacgaataa

DBGET integrated database retrieval system