KEGG   Turneriella parva: Turpa_0016Help
Entry
Turpa_0016        CDS       T02157                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tpx  Turneriella parva
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpx00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Turpa_0016
Enzymes [BR:tpx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Turpa_0016
Exosome [BR:tpx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Turpa_0016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pTURPA.01:15349..16821
Genome map
AA seq 490 aa AA seqDB search
MAKPYIVTIDQGTTGSRVFLISERGEVISSAYEEFTQHFPRPGWVEHDAEEIWASVEKLL
ARAIEASDAAAIGITNQRETTVVWEKSTGKPIHPAIVWQCRRTADYCEQLKKEGRAELFR
KKTGLVLDAYFSGTKIKYILDNVGGARSRAENGELLFGTIDTFLLNRLTGEHKTDFTNAS
RTLIFNIHERKWDAELCEILKIPQKILPSAQASSSLFGKTKGLKALPDGVPVYSLIGDQQ
SALYGQLCHNPGEAKNTYGTGCFVVMNLGDKFLESKNGLITTLACDAHGNPVYALEGSIF
IGGAVVQWLRDKMHFFDDSGKSESLAKSANDESEVVFVPAFAGLGAPYWDQNARGAILGL
TRDTTSAQITQAALKAIALQSYDVIAAMQADSGLKLPVLKVDGGATRNNYLMEFQAGVLG
ASVVAPRNAETTVLGAAYLAGLGAKIWSSPEDLASLNPPAATFHPVMTAAQRERELKLWK
DAIGRVLTTR
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaccctacattgtaacgatcgatcaaggcacgactggatcgcgcgtcttcttg
atctctgaacgcggcgaggtgatctcgagcgcgtacgaagaattcacgcagcattttccg
aggcccggctgggttgaacacgacgccgaagagatttgggcaagtgttgaaaagttgctc
gcgcgggccatcgaggcatcggacgctgcggcgataggcattacgaaccagcgcgagacg
actgtcgtctgggaaaaaagcaccggcaaaccgatacatcctgctattgtctggcaatgc
cgccgcaccgcagactattgtgagcaactcaagaaagagggcagggcggagctctttcgg
aaaaaaacgggtcttgtgctcgacgcctatttttcagggacaaaaattaagtacattctc
gacaatgtcggtggtgcgcgcagccgcgccgaaaatggcgaattgctgtttggcacgatc
gacacatttttgttaaaccggctgacgggtgagcataagaccgacttcaccaacgcgtca
cgcactctgattttcaatattcatgagcgtaaatgggatgccgagctctgtgagatcctg
aaaattccacaaaaaattctgccgtcggcgcaggcgagcagcagcctctttggcaagaca
aaggggctcaaggcgctgcccgatggcgtgccggtctattcgctgatcggcgaccagcaa
tcggctctttatggccagctgtgccacaaccccggcgaggcaaagaatacctatggcact
ggctgttttgtggtgatgaatctcggcgataaatttctcgagagcaagaacggcctgatc
acgactcttgcctgcgatgcgcacggcaacccggtctacgcactcgaaggttcaattttt
atcgggggtgcggttgtgcagtggctgcgcgacaagatgcatttcttcgacgactcgggt
aagtcagaaagcctcgcgaaatccgcaaacgacgaatcagaagttgtgtttgtgcccgca
ttcgcaggcctcggcgcgccctattgggaccagaatgcgcgcggtgcaattctcggcctg
acgcgcgataccacgtcggcgcaaattacgcaggctgcgctcaaagcaatcgcgctgcaa
tcgtacgacgtcatcgcggcgatgcaggccgacagcggtctcaaattaccggttctcaag
gttgatggtggcgccacgcgcaacaattatctgatggaatttcaggccggggttttgggt
gcttcagtggttgcgccacgaaatgccgagacgacggttctgggtgctgcctacctcgca
ggcctcggcgcgaaaatttggtcatcgcctgaagatctggcaagcctcaacccgccagcg
gcgacgtttcacccggtcatgacagccgcgcaacgcgagcgcgaactaaaactgtggaaa
gatgcgattgggcgcgtgctgacgacgcgctga

DBGET integrated database retrieval system