KEGG   Turneriella parva: Turpa_0019Help
Entry
Turpa_0019        CDS       T02157                                 

Definition
Di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
tpx  Turneriella parva
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pTURPA.01:18222..19193
Genome map
AA seq 323 aa AA seqDB search
MKKYLIYFIAAVAALQCGPKVDYAELRTRAKSAFGTLPAKMPGSEKDTPELIALGKMLYN
DRRLSINDTQSCASCHILEGKKGGVDNTKFSPGAKGSLGGRNAPTTLNAGFHFVQFWDGR
AANLTEQAKGPVLNPVEMGMPSEKAVVDKISQVAEYKEAFPKAFPGSKNAITYQNIAEAI
AAFERTLITRDRFDDFINGDDKAMTKEELLGMQTFMNQGCTTCHIGQLLGGNSYRKMGQA
RPYETKDLGRFDVTKKEEDKFMFKVPSLRNVALTEPYFHDGSAATLSEAVAKMAYHQLGK
ELGEKDVASIVTFLKALTDKQRQ
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatacttaatatactttattgcagccgtggctgccctgcaatgcgggcccaag
gttgactacgctgaattgcgcacgcgggcaaaatcggcgttcggtacgctgccggcaaaa
atgcctggctctgaaaaagacaccccagaactcattgctctgggcaaaatgctctataat
gaccgtcggctgtcaatcaatgatacccagtcgtgcgcgagttgccacattctcgagggc
aagaagggcggggtagataacaccaaattcagccccggcgcgaagggctcgctcggcggc
cgcaatgcgccaacgacccttaatgctggctttcactttgttcaattctgggatggccgc
gcagcgaacctcactgaacaggcgaaaggcccggtattgaacccggttgaaatgggcatg
ccgagcgaaaaggccgtggtcgataagatttcgcaggtcgccgaatataaagaggctttc
cccaaggcttttccgggttcaaagaatgcgattacttaccagaacatcgccgaagcgatt
gcagcgtttgagcgcactttgatcacgcgtgaccgcttcgatgacttcattaacggcgac
gataaggcgatgaccaaagaagaactattgggaatgcagactttcatgaaccagggttgc
accacttgccatatcggtcaattgctcggcggcaacagctacagaaaaatgggccaggct
cgcccatatgaaacaaaagatcttggccgcttcgatgtcaccaagaaagaagaagacaag
tttatgttcaaggtgccgtcgctgcgtaacgttgcgctgaccgaaccctatttccatgat
ggttctgccgccacgctttctgaggccgtggcaaaaatggcctaccaccagctcggcaaa
gaactgggcgaaaaagatgttgcttcaatcgtgacatttctcaaggctctgacagacaaa
cagcgacagtag

DBGET integrated database retrieval system