KEGG   Turneriella parva: Turpa_0096Help
Entry
Turpa_0096        CDS       T02157                                 

Definition
L-threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tpx  Turneriella parva
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tpx01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:tpx00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:tpx00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
62644..63969
Genome map
AA seq 441 aa AA seqDB search
MSQAWFQSINPQYTDRYALDQIIYRCPGSGDLLEVRHDMDALKKKSAQDWRDLFESRWRS
QNKADASGIWGKREWVLPELPVEDIVTLGEGATALFSGAELSRQFAHQDIFVKLCGNSHT
GSFKDLGMTVLVSQVNHMIKKGAPIRAIACASTGDTSAALAAYAAYAGILSVILLPKNKI
SLAQLMQPIANGSLVLALDTDFDGCMEIVQQLTLEKDIYLANSMNSLRIEGQKTVGIEVA
QQLGWQLPDWFIIPGGNLGNVSALSAGLKMLYELGLVNSLPRIAVAQAEAANPLYLASKN
GFKDFQPITAKETAASAIRIGNPISVKKAIATLKEFGGVVEQASERELADAAALGDKAGL
LVDPHTGVALAAFKKLKAAGVIREHESAVVISTAHGLKFADFKINYHSPESTAPHKNLPV
DLKPTLGAVKDAVAAFLDKKK
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
gtgtcccaagcctggtttcaaagtataaatccgcaatacacagacaggtatgcgctcgac
cagattatctatcgctgccccggttcaggcgatctgctcgaggtgcgccatgacatggac
gcgctcaagaagaaatcggctcaggactggcgtgacctctttgaaagccgctggcgctcg
cagaataaggccgacgcctcgggcatctggggcaaacgcgaatgggttttgcccgagttg
cccgttgaagatattgtaacgctcggcgaaggcgcaacagcgcttttttcgggcgccgaa
ctttcgcggcaatttgcacaccaggatatctttgtaaaactctgcggtaacagccacacg
ggttcgtttaaagacctcggcatgacggtgctcgtctcgcaggtgaaccacatgatcaaa
aagggtgcgccgattcgcgcgatcgcctgcgcctcgacgggtgacacttcggctgcgctc
gccgcgtacgcggcgtatgcgggtatcttgagcgtcatacttttgccgaagaacaagatc
tcactcgcgcagctgatgcagccgatcgcaaacggttctctcgtgctcgcactcgacacc
gacttcgacggctgcatggagattgtgcagcagctcaccctggagaaagacatctacctg
gccaattcgatgaacagtctgcgcatcgaaggtcagaagactgtgggcatcgaagttgcg
caacaactcggttggcaacttcccgattggttcataattcccggcggtaacctcggcaat
gtttcggcgctcagtgcgggcctcaagatgctctatgaactcggcctcgtgaactcattg
ccgcgcattgcggtggcacaggccgaagcggccaaccctctctacctcgcgtcaaaaaac
ggcttcaaagattttcagcctatcacggcgaaagagacagcggcgtctgcaatccgcatc
ggcaacccgatctcggtcaaaaaggcgatcgctacgctcaaagagtttggcggcgtcgtt
gaacaggcgtcagaacgcgagctcgctgatgctgcggcgctcggcgacaaggcgggttta
ttggtcgacccccatacaggtgttgcgctggcggcgttcaaaaagctgaaggccgccgga
gtgattcgcgaacacgaatcggccgtcgtgatttcgacggctcacggcctcaagtttgcc
gatttcaaaatcaactaccattccccagaatcgactgcgccgcataaaaatctgccggtt
gatctgaagccaacgctcggtgccgtgaaagatgcggtggcggcgtttctcgacaagaaa
aaataa

DBGET integrated database retrieval system