KEGG   Turneriella parva: Turpa_0096Help
Entry
Turpa_0096        CDS       T02157                                 

Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tpx  Turneriella parva
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tpx00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Turpa_0096
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Turpa_0096
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Turpa_0096
Enzymes [BR:tpx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Turpa_0096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
62644..63969
Genome map
AA seq 441 aa AA seqDB search
MSQAWFQSINPQYTDRYALDQIIYRCPGSGDLLEVRHDMDALKKKSAQDWRDLFESRWRS
QNKADASGIWGKREWVLPELPVEDIVTLGEGATALFSGAELSRQFAHQDIFVKLCGNSHT
GSFKDLGMTVLVSQVNHMIKKGAPIRAIACASTGDTSAALAAYAAYAGILSVILLPKNKI
SLAQLMQPIANGSLVLALDTDFDGCMEIVQQLTLEKDIYLANSMNSLRIEGQKTVGIEVA
QQLGWQLPDWFIIPGGNLGNVSALSAGLKMLYELGLVNSLPRIAVAQAEAANPLYLASKN
GFKDFQPITAKETAASAIRIGNPISVKKAIATLKEFGGVVEQASERELADAAALGDKAGL
LVDPHTGVALAAFKKLKAAGVIREHESAVVISTAHGLKFADFKINYHSPESTAPHKNLPV
DLKPTLGAVKDAVAAFLDKKK
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
gtgtcccaagcctggtttcaaagtataaatccgcaatacacagacaggtatgcgctcgac
cagattatctatcgctgccccggttcaggcgatctgctcgaggtgcgccatgacatggac
gcgctcaagaagaaatcggctcaggactggcgtgacctctttgaaagccgctggcgctcg
cagaataaggccgacgcctcgggcatctggggcaaacgcgaatgggttttgcccgagttg
cccgttgaagatattgtaacgctcggcgaaggcgcaacagcgcttttttcgggcgccgaa
ctttcgcggcaatttgcacaccaggatatctttgtaaaactctgcggtaacagccacacg
ggttcgtttaaagacctcggcatgacggtgctcgtctcgcaggtgaaccacatgatcaaa
aagggtgcgccgattcgcgcgatcgcctgcgcctcgacgggtgacacttcggctgcgctc
gccgcgtacgcggcgtatgcgggtatcttgagcgtcatacttttgccgaagaacaagatc
tcactcgcgcagctgatgcagccgatcgcaaacggttctctcgtgctcgcactcgacacc
gacttcgacggctgcatggagattgtgcagcagctcaccctggagaaagacatctacctg
gccaattcgatgaacagtctgcgcatcgaaggtcagaagactgtgggcatcgaagttgcg
caacaactcggttggcaacttcccgattggttcataattcccggcggtaacctcggcaat
gtttcggcgctcagtgcgggcctcaagatgctctatgaactcggcctcgtgaactcattg
ccgcgcattgcggtggcacaggccgaagcggccaaccctctctacctcgcgtcaaaaaac
ggcttcaaagattttcagcctatcacggcgaaagagacagcggcgtctgcaatccgcatc
ggcaacccgatctcggtcaaaaaggcgatcgctacgctcaaagagtttggcggcgtcgtt
gaacaggcgtcagaacgcgagctcgctgatgctgcggcgctcggcgacaaggcgggttta
ttggtcgacccccatacaggtgttgcgctggcggcgttcaaaaagctgaaggccgccgga
gtgattcgcgaacacgaatcggccgtcgtgatttcgacggctcacggcctcaagtttgcc
gatttcaaaatcaactaccattccccagaatcgactgcgccgcataaaaatctgccggtt
gatctgaagccaacgctcggtgccgtgaaagatgcggtggcggcgtttctcgacaagaaa
aaataa

DBGET integrated database retrieval system