KEGG   Turneriella parva: Turpa_0163Help
Entry
Turpa_0163        CDS       T02157                                 

Definition
hypothetical protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
tpx  Turneriella parva
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tpx00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Turpa_0163
Enzymes [BR:tpx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Turpa_0163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
131111..132529
Genome map
AA seq 472 aa AA seqDB search
MSEFKYLTDQLIADADLWNQVPLSLAERESLISQFLAGEIAVEASERTAGMLATEYFDLT
EINGAMHFIPGRYKDMFTFFLQSLNRARGQRSAAIMPGVNTLVTGGPGTGKSYQISRFVE
SLAAKQTDSPVRVAIAAPTGKAAARFTALEALPNLLLECLTIHRLMQLSPDGSRAKYDAP
NPLPVDVLIVDEISMVDLGLFARLIGALPLHAQVVLAGDIGQLPAVDGIAIAPALEFLAE
QGLLTHLELTVTHRFSASKAAVYAALQSDGISAVTAQSEGIRLIEIQDTQALNLHVENYA
REIYRTPGFTALAERLAQTPFPGTTWQKAAKDILQQLQRSIILCESNEGSHGTSALNRRI
AAVCTGNRVTPIMVTANSYELQLFNGDTGFIFNDGNHEHVIIESAGRVKRLPLGRLRHWQ
IAYAITIHKSQGSEYQMVHIVHETRKNPERDHRLLYTAVTRAREQAVILKMH
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaattcaaatatctcaccgatcagttgatcgccgacgccgacctctggaatcaa
gtgccgctgagcttggctgagcgcgagagtctgatctcacagtttctcgcgggcgaaatt
gccgttgaagcttcagagcgaaccgccggcatgttagcaaccgaatactttgaccttacc
gagataaacggcgcaatgcattttattccgggccggtacaaagacatgtttacattcttt
ctgcagtctctgaaccgtgcgcgcgggcagcgcagcgctgccatcatgcccggggtaaac
actcttgtaactggtggccctggcaccggtaagagctaccaaatatctcgttttgtcgag
tcgctcgccgcaaaacagacagattcaccggtgcgcgtggcaattgccgcgcccacgggc
aaagctgcagcacgcttcacagcgctcgaagcgctgcccaatttgctgctcgaatgcctc
acgattcaccggttgatgcaactgagcccagacggcagccgggcaaagtacgatgcgccg
aacccgctgcctgtcgatgttctcatcgtcgatgaaatttcgatggttgatctcggcctc
tttgcacgactgatcggggcgctgccgctgcacgcccaggtcgtgctcgcgggcgatatc
gggcaactgccggccgtcgacggcattgcgattgctcccgctttggaatttctggccgag
caaggtctgctcactcaccttgaactcacagtcacccatcgattttctgcgtcaaaagcg
gccgtttatgcggcattgcagagcgacggcatttcagccgtaactgctcaatcagagggc
attcgcctcattgaaattcaagacacgcaggccctgaatcttcacgtcgaaaactatgct
cgggaaatctatcgcacgcccgggttcaccgcgctcgccgagcggctggcccaaacgcct
tttcctgggacgacctggcaaaaagcggcgaaagatattctgcagcagcttcagcgcagc
atcattctgtgcgaaagcaacgagggcagccacggcacctcggcgttgaaccgacgcatt
gcggcagtctgcacgggaaaccgggtgacgccgattatggtaacggccaatagttatgag
ctgcaactctttaacggcgatacaggtttcatatttaacgatggaaatcacgagcatgtg
atcatcgaaagcgcaggcagagtgaagcgtctgccgctcggtcggctgcgccactggcaa
atagcgtacgcgatcactatacacaaaagccagggatcagagtaccagatggtgcacatc
gtgcacgaaacacgaaagaaccccgagcgtgatcatcggctgctctatactgcagtgaca
cgcgcccgtgagcaggcggttattttaaagatgcactga

DBGET integrated database retrieval system