KEGG   Turneriella parva: Turpa_0205Help
Entry
Turpa_0205        CDS       T02157                                 

Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
tpx  Turneriella parva
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:tpx00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Turpa_0205
Enzymes [BR:tpx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     Turpa_0205
Amino acid related enzymes [BR:tpx01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Turpa_0205
Transfer RNA biogenesis [BR:tpx03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Turpa_0205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
176989..178545
Genome map
AA seq 518 aa AA seqDB search
MSEIRTRFAPSPTGYLHVGGARTALFNYLYARSQKGKFILRIEDTDQARSTEQSYHQVID
SLKWLGYEWDEGPEVGGPHGPYKQSERLHIYKEYGEKLVAEKKAYPCFCTGDELDRKKKQ
REAMGLPYVYDGKCRALTPDEVAEKKAQGLAHTLRFRTPSKEVVVEDMVQGTVRFDTALI
GDFIIVKSDGFASYNYAVVVDDHLMDITHVIRGVGHLSNTPRQVLIYEAFGWKVPAWAHV
SEIVGSDHKKLSKRHGATPITAFRDLGYTARAFNNYMALLGWSSPDGREYMSIAEQKSIF
DVARCSKSPAMFDVFDLAKAAEVDLAQVSISELETYLFPKSKLNWLSNQHIRATPDDDFI
AEILPFVAATGVVPSGECNADNERLRGILLSLRVYLDTLGQIKQYLADFYLPFNPVLENY
VSSEYFAAENFSSLAGAMLRQIEQMGDATDTLEQNAIKDAINAVGKETGLKGKPLFMGVR
LASTGRLEGLELPVYLNLLGKGRVTERLSKMVALKKAS
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaatccgcacccgtttcgcaccctcacccacaggttacctgcatgtcggtggc
gcgcgcaccgcactttttaactatctctatgctcggtcgcaaaagggaaaatttattctg
cgcattgaagataccgaccaggcgcgctcgaccgaacagagctaccaccaggtaatcgac
tcgctgaaatggctcggttatgaatgggacgaaggccccgaggtcggcggcccgcacggc
ccgtacaaacaatctgagcgcctgcatatctacaaagaatacggcgaaaaactcgtcgct
gaaaaaaaggcgtacccgtgcttctgcacgggagatgaactcgatcgcaagaagaaacag
cgtgaagccatgggcctgccctatgtctatgacggcaaatgccgtgcgttaaccccagac
gaagtggctgagaaaaaggcgcaggggcttgcgcacaccttgagatttcgcacgccttcg
aaagaggttgttgtcgaagacatggttcaggggaccgtacgcttcgatacggcgctcatt
ggcgacttcatcatcgtcaaatctgacggctttgcttcgtacaactatgcggtcgtcgtc
gacgatcatcttatggacatcacgcacgtaattcgcggcgttggccatctttcaaacacc
ccgcgccaggttctgatctacgaagccttcggctggaaggtacccgcatgggcgcatgtc
agtgaaatcgtcggctcagaccacaaaaagctttcgaagcgtcacggggcaactcccatc
accgcttttcgcgacctcggttacacggcgcgcgcattcaataactatatggcattattg
ggctggtcgtcgcccgacggccgagagtacatgtcgatcgccgaacagaaatcgatcttt
gacgttgcccgttgcagcaaatcgccggcgatgtttgatgtattcgacctcgccaaagcg
gcagaagtcgatctggcgcaggtttcaatatctgagctcgagacttatctttttcccaaa
tcgaaactgaactggctttcgaaccagcacatacgtgcgactcccgacgatgatttcatc
gccgaaattctgcccttcgtcgcggcgaccggtgttgtgccttctggcgagtgcaatgcg
gataatgaacgtctgcgcggcattttgctttcgctcagggtttatctcgatacgctcggg
cagattaagcagtacctggcagacttctacctgccctttaacccggtgttagagaattat
gtctcatcagagtactttgcagcagaaaatttttcgtcgctcgccggggcaatgctacgt
caaatagagcagatgggcgatgcaacagatacactggaacagaatgctataaaagatgcg
attaatgccgtcggcaaagagacgggacttaaaggcaagccgctcttcatgggtgtcagg
ctcgcttcaacaggccggctcgaagggctcgaactgccggtttatctgaacctgctgggc
aaagggcgcgtaacagagcgtctctcaaaaatggttgccctcaagaaggcctcgtga

DBGET integrated database retrieval system