KEGG   Turneriella parva: Turpa_0282Help
Entry
Turpa_0282        CDS       T02157                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tpx  Turneriella parva
Pathway
tpx00260  Glycine, serine and threonine metabolism
tpx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tpx01100  Metabolic pathways
tpx01110  Biosynthesis of secondary metabolites
tpx01130  Biosynthesis of antibiotics
tpx01230  Biosynthesis of amino acids
Module
tpx_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tpx00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Turpa_0282
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Turpa_0282
Enzymes [BR:tpx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Turpa_0282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth DUF5440
Motif
Other DBs
NCBI-ProteinID: AFM10942
UniProt: I4B0Y5
Position
complement(268330..269133)
Genome map
AA seq 267 aa AA seqDB search
MHPFTRALNERKKQKGYLFIPYIAYGDPDAKITAEIITKMIEGGAATVEIGLPFTDPVAD
GPALERAFKRSLKNEFRVADVLAMLQKLHKKFPGFPFTIMSYANIFYQAGFKNLLEKLYE
CNVQGIIIPDIPHDEKKYIIEREGLGDILTRIAWIDFVTPTTPAKKIQEIARDAQGFIYL
VSYKGVTGQKNFTLKPLKPVIKAIRRATRVPLVVGFGIKDKVHASEAARLTDGFIMGTVF
HEMIEHNIERAPAIPHEIGWALPGMLP
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcatccgttcacgcgtgctttaaacgagcgcaagaagcagaaaggatatctctttatc
ccctatatagcctatggtgatcccgatgcaaagatcactgcagaaataatcaccaagatg
atcgagggtggcgcggcgacggttgagattggcctgccgttcaccgaccccgttgccgat
ggcccggcgctcgagcgcgcattcaagcgctcgctcaaaaacgaattcagggtggccgac
gtattggccatgctgcagaaactacacaagaagtttcccggctttccctttacgatcatg
agttatgcgaatattttctaccaggcgggcttcaaaaatctgcttgaaaaactttatgaa
tgcaatgtccaggggattatcatacccgatattccgcacgatgagaaaaaatatatcatc
gagcgcgaaggtctcggtgacattctgacccgcatcgcgtggatcgatttcgtaacgccg
acgactcccgctaaaaaaattcaagagattgcgcgggatgctcaggggttcatttatctt
gtctcttataaaggtgttacgggtcagaagaatttcacgctgaagccgctgaaacctgtg
atcaaggcgattcgccgcgcaacgcgcgtgccgctcgttgtcggcttcggtattaaagac
aaagtacatgccagcgaagcggctaggctcaccgatggtttcatcatgggcaccgtgttt
cacgaaatgatcgagcacaatatcgagcgcgcgcctgcgataccgcatgaaatcggctgg
gctctgcccggcatgttaccttag

DBGET integrated database retrieval system