KEGG   Turneriella parva: Turpa_0324Help
Entry
Turpa_0324        CDS       T02157                                 

Definition
asparagine synthase (glutamine-hydrolyzing)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
tpx  Turneriella parva
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tpx00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Turpa_0324
Enzymes [BR:tpx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Turpa_0324
Peptidases [BR:tpx01002]
 Cysteine Peptidases
  Family C44
   Turpa_0324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
310795..312831
Genome map
AA seq 678 aa AA seqDB search
MCGISAIFSKNNFRSDEFIAMTDVIRHRGPDDEGYATVSATGKISFFAGKDTPAACRSAS
QKKKYPYLPDARLTANSLSTAKKGEGQIIAALGHRRLSIVDTSPAGHQPMTFDNRLAIVY
NGEVYNHIELRNELEARGRRFVSHSDTEVILQAYDEWGIACLSKFNGMFAFVIYDLRNDH
VFAARDRFGVKPLYYYSSGDALAFASEIKQFTVLEGWQSKLNRRRGYDFLVYGIHEHTDE
TFFENVFQFSPGSFFYGKREALLGNNPRIDTSKWYIFPAEKKFRGSFNDAAAQFHELLKD
SVRLRLRADVPVGSCLSGGMDSSAIVCVMNELLKEQGAHALQKTFSACAKEKAFDEREFI
EVVVKHTGVKGHYIYPQLKDLFRISDKILWHQDQPYGSTSIFAQWNVFALAHKHRVKVML
DGQGADEQLGGYASYFMPWLASLVRSFRWLKLAQEAKALHQIHGVNMGRLSWFAANTLLP
MPVRSYLKKHLRGVKLAPDWLHMERLGFDAYDLPRQLGITTSRSIRDLSLSQLTGSNLQM
LLHYEDRDSMAHSVESRVPFLDYRLVEHVYSLPDDYKIYNGRTKFVLREGLKNVLPEKIY
SRNSKLGFATPEEIWVRQDAPYEFRKRLKVAVETSDGLIDPSIQELLEQQISGRASFSFL
IWRILSFSDWLRIFSAQI
NT seq 2037 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcatatccgcgatcttctccaagaacaatttccggagcgatgagttcatcgcc
atgacagacgtcatccgccaccgcggacctgacgacgaaggttatgcgactgtctcagca
accggtaagatttcttttttcgcgggcaaagatactccggccgcgtgccgctcagcgagc
cagaagaaaaaatatccctacttgcctgatgcacggctaaccgcaaatagcctttcgacg
gcgaagaaaggcgaaggccagataatcgctgcgttggggcaccgccgcttatcgatcgtc
gacacctccccggcgggtcaccagccgatgacatttgataaccgcctggcaattgtctac
aacggcgaagtctataaccacattgaactgcgcaacgagctagaagcgcgcggccgccga
ttcgtctcgcacagtgacactgaagtcatacttcaagcatacgatgaatggggaatcgcc
tgtctctcaaaattcaatggtatgttcgcctttgtgatctatgacctgcgcaacgatcat
gttttcgcggcgcgtgaccgttttggcgtaaagccactctactactacagctctggcgat
gccctcgcattcgcgagcgagatcaaacagtttacggtgctcgagggctggcagagcaaa
ctgaacaggcggcgcggctatgattttctggtctatggcattcatgaacatactgacgaa
actttttttgagaacgtgtttcagtttagcccaggcagctttttctacggaaagcgggag
gctttactcggcaacaaccccagaattgacacctctaaatggtatattttccctgcagag
aagaaattccgaggtagctttaatgatgcagccgcacagtttcacgaactgctaaaagat
tcggtacgtttgcgactaagagccgatgtgccggtaggttcatgcctttctggtggcatg
gattcttcggcaatagtctgtgtcatgaatgaattgctgaaagaacaaggggcacatgcc
ctgcagaaaacattctcggcctgcgccaaagaaaaggcatttgacgaacgcgaattcatt
gaagtcgtcgtaaagcataccggggtcaaagggcactatatttatccacaactgaaggat
ctatttcgaatctctgacaaaattctttggcaccaggatcaaccgtacggttcgacgagt
attttcgcacagtggaacgtttttgcgctggcgcacaagcaccgcgtcaaagtgatgctc
gatgggcaaggggccgatgaacagctggggggttacgcctcgtactttatgccgtggctc
gcaagcctcgtgcgtagctttcgctggctgaaactcgcgcaagaagcgaaggcccttcac
cagattcatggggtcaatatggggcggctatcctggtttgccgccaatacgttactgccc
atgcctgtccgctcgtacctgaagaagcatctacgcggcgtaaaactggcgccagactgg
cttcatatggaaagactgggttttgatgcatacgatctgccccggcagctgggtataacc
acgagcaggtcgattcgcgacctgagcctttcgcagctcacgggttcgaatctgcagatg
ctgctgcattacgaagaccgcgactcgatggcacattctgtcgagtcgcgcgtacccttt
ctcgactacagacttgtcgaacatgtatattcattacccgatgactataagatctataat
ggtcggaccaagtttgtcctccgcgaagggctcaagaatgtattgcccgagaagatttat
tcccgcaattcaaaactcggcttcgccacgcctgaagaaatctgggttcggcaagacgcc
ccctacgagtttagaaagcgtctgaaggtggcagtcgaaaccagcgatgggctgattgac
ccgtcgattcaagaattactggaacaacaaatctctggtagggcaagtttttcttttctc
atttggcgcatcttgtcattcagtgattggctacgaatatttagcgcccagatttag

DBGET integrated database retrieval system