KEGG   Turneriella parva: Turpa_0328Help
Entry
Turpa_0328        CDS       T02157                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
tpx  Turneriella parva
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tpx00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Turpa_0328
Enzymes [BR:tpx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Turpa_0328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
315398..316441
Genome map
AA seq 347 aa AA seqDB search
MAQQHLMHTVFAPAKINLGLRITGRFANGYHRLESLFVPVSLFDRIEVRLSAADRVQHIW
PIGEPTPKRRLLSLGALKNPLLWKTIALVRERLRDHADLELPRVAVTVDKRIPSPSGLGG
ASSDAAALIQALCLVAKAAAPDKSAQINEALQSDLFLKETTQLGADVPYFWRYGLEARAA
MLNGIGHELAALEINNIGGFLCVPPFGFSTERMFAHVRSLPLPTAEATGGESAASKLALR
LSEIPYSDEVVFGVKFVQNDFDRAAAAVFPNESRLLAQAKVAIARTVNQFFGSGFVVGMS
GSGAALFAATETPVSQTMLAAYSGVLRARLGRDWRVFTFSTAGLRPP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagcagcacctgatgcatactgtttttgccccggcgaagattaatctcggcctt
cgcatcaccggccggtttgccaacggctaccaccgcctcgaatcgttgtttgtgcccgtg
tcgctgttcgaccgcatcgaagtgaggctctcagcggccgaccgcgttcaacatatctgg
ccgattggcgaacctacgcccaaacgccggctgctgtctctgggggcgctcaagaacccc
ttgctatggaaaaccatagctctggtgcgagagaggctgcgcgaccatgcggatttagaa
ttgccgcgcgttgcggtcacggtcgataaacgtattccctcgccttcagggctgggcggc
gcttcgtcagatgcggctgcgctgattcaggcgctatgcctcgtggcaaaagccgcggcg
cccgacaaaagcgcgcagattaatgaggctttgcaatccgacttatttctcaaagaaacc
acacagctcggggccgacgtaccctatttttggcgctacggccttgaggctcgggcagcg
atgctcaacggcattggccacgaacttgcggcactcgaaatcaataacatagggggattt
ctctgcgtaccgccattcggcttttcgacagaacgcatgttcgcgcacgtgcgaagcctg
ccattgcccaccgccgaggcgacaggcggcgaatctgccgcatctaaattggctttacgc
ctcagcgaaattccctattcggacgaggtcgtctttggtgtgaaattcgtgcaaaacgat
tttgaccgggctgcggcagcggttttcccgaatgaaagccggttgctggcgcaggcaaag
gtggcgattgcccgaacggtgaaccagttcttcggttcgggttttgtagtcggaatgtca
ggttcaggggcagcgctatttgccgccacagaaacaccggtttcgcaaacgatgctggca
gcgtattcgggtgtgcttcgcgcacgcctcggccgcgactggcgtgtatttactttttct
acggcgggcttacgcccgccgtag

DBGET integrated database retrieval system