KEGG   Turneriella parva: Turpa_0448Help
Entry
Turpa_0448        CDS       T02157                                 

Definition
CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
tpx  Turneriella parva
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:tpx00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Turpa_0448
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Turpa_0448
Enzymes [BR:tpx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Turpa_0448
Two-component system [BR:tpx02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Turpa_0448
Bacterial motility proteins [BR:tpx02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Turpa_0448
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(451943..452545)
Genome map
AA seq 200 aa AA seqDB search
MNALYHHASKLVAIGASAGGPHAIETVLGELGADMPPILITQHMPEVFTRAFARRLDEIM
ALTVVEADATEKLKSGTVYIAPGDRHLIVRRQGLELFATTDAGPPVNRHRPSVDVLFESV
VSAAPASAMGIILTGMGNDGARGLAAMRHAGFLTIAQDEATSVVWGMPREAVKLEAVDGS
HILPLSKIGPAIKNFVKLPI
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgctataccatcacgcatcgaagttggttgctataggcgcttcggccggcggg
ccgcacgcaattgaaacggtgctgggtgaacttggcgccgacatgccgccgattctcatc
acgcagcacatgcccgaagtctttacgcgcgcattcgcgcgccggctcgacgaaattatg
gcgctcaccgttgttgaggccgatgcgaccgaaaagctgaagtcgggcacagtctacatc
gcacccggcgaccgccacctcatcgtcaggcgccagggcctcgaactattcgcgaccacc
gatgcgggcccgccggttaatcgccaccggccttctgtcgacgtgcttttcgagtcagtc
gtcagcgccgcaccggcatcggccatgggaatcattctcaccggcatgggaaacgatggg
gcacgcgggctggcagcaatgcgccatgcaggatttctcacgatcgcgcaagatgaagcg
acttcggttgtctggggcatgccgcgagaggcggtcaaactcgaagcggtcgacggctcg
cacatattgccgctctcaaaaatcggccccgctataaagaattttgtgaagttacctatt
tag

DBGET integrated database retrieval system