KEGG   Turneriella parva: Turpa_0596Help
Entry
Turpa_0596        CDS       T02157                                 

Definition
Di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
tpx  Turneriella parva
Brite
Enzymes [BR:tpx01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Turpa_0596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(604904..606118)
Genome map
AA seq 404 aa AA seqDB search
MCSSRWAVIILAGSLIACENFDPQLTTPSSRYVWQIPANIPAPRELADNPMTYEKVALGR
HLFYEKRLSGNRTFSCATCHHPSHAFADDPNIDDGSADFSKSGLNRITVAKGSTGEFHPR
NSMQLINLAWQPVLTWGNPLMVRLHTQAQVPLFGENPVELGLVGLEESRLSELRSDPVYQ
KLFAAAFSQSGNPYTMGNVTRALEAFQRSIIGFDSPYDRFSRGESGAISASAVNGFNMFF
SEEFECFHCHGGINFTNSEDHSRKAFAEIDFANNGLYNIGGTGAYPTGNTGIKEVTGLVS
DMGRFKAPTLRNIELTAPYMHDGSIADLDGVLDHYARGGRLISSGPNAGDGSLSPFKNSF
VKGFTLTTQQRADMIEFLRSLTDAKFIANTAYSNPWPQGHLNNP
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtgtagcagccgctgggctgtaatcattctcgcaggcagtctcattgcctgcgagaac
tttgatccacagctgacaacgccgagctcaagatacgtctggcagataccggcgaatata
cctgcgccgcgcgagctggccgacaaccccatgacctatgaaaaggttgctttggggcgc
cacctattttacgagaaacgcctctcgggaaaccgcacattttcgtgcgcgacctgccac
cacccgtcgcacgcatttgccgacgaccccaacattgacgacggcagtgccgatttcagc
aagagcggtctcaatcgtatcactgtcgcgaaaggttcaacgggggagtttcacccgcgt
aacagcatgcagctcataaaccttgcctggcaacctgtgctgacgtggggcaatccgctc
atggtgaggctgcacacgcaggcgcaggtgccgctcttcggagaaaatcccgttgagttg
ggcctggtcggcctcgaggaaagccgcttgagtgagctcaggtctgatccggtttaccag
aagttattcgccgcagccttttcgcagagtggaaatccatacacaatgggcaatgtgacc
cgtgctctcgaggcatttcagcgttccattatcggcttcgattctccatacgatcgtttc
tcgcggggtgaatcgggggctatcagcgcctctgctgtgaacggcttcaatatgttcttc
agcgaagagtttgagtgctttcattgccatggcggcatcaacttcaccaacagcgaagac
cattcgcgcaaggcatttgctgaaatcgattttgccaacaacggcctctataatattggc
ggcacaggggcatacccaaccggcaacacgggtatcaaagaagtcacgggtctggtgagt
gacatgggcaggttcaaagctcccaccctgcgcaatattgaactcacagcgccctatatg
cacgatggttcgatcgccgatctcgatggtgttctggatcattacgcacgcggcggccgc
cttatctccagtggcccaaatgcgggggatggttcgctttcaccattcaagaattcgttc
gtcaagggtttcactctgaccacccaacaacgggccgacatgatagagtttcttcgctcg
ctgaccgacgcgaagttcatagccaacacggcttacagcaatccatggcctcagggtcat
ctcaacaatccatag

DBGET integrated database retrieval system