KEGG   Turneriella parva: Turpa_0626Help
Entry
Turpa_0626        CDS       T02157                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
tpx  Turneriella parva
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tpx00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
634775..635320
Genome map
AA seq 181 aa AA seqDB search
MLIKDWLAANITKDVRALDWFDDAEAEPRIRKAYQELLSGYSIDPSTLLKTTREIGKNEK
FTGSVTVRDINYFSICAHHFLPFYGKVDITYEPGEIIIGLGKFPRLVQAYSRRFQIQEDM
VKEIAEEIMTSGKARGVYVKSTGRHMCMCSRGPSDHTAETDTEFAMGTLLERYLQPPGRA
R
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgctgataaaggattggcttgctgccaatatcaccaaagatgtccgggcgctcgattgg
ttcgacgatgcagaggccgagccgcgcatacgcaaggcctatcaagaactgctgagcggc
tattcgatcgacccctcaaccttgctcaagactacccgcgaaatcggcaaaaatgaaaaa
ttcaccggcagtgtaaccgtgcgcgacatcaactatttttcgatctgcgcgcaccacttt
ctgcctttctacggaaaggttgacatcacgtacgagcccggtgagattattatcggcttg
ggtaagtttccccgattggtgcaggcatattcacgccgctttcagattcaagaagatatg
gtgaaagagatcgctgaagaaatcatgacctcgggcaaagcccgtggcgtttacgtgaaa
tcgacgggtagacacatgtgcatgtgcagccgtggcccatcagaccacacagcagagaca
gacacagaattcgcgatgggcactctgctcgagcgttacctgcagccccctggcagagcg
aggtaa

DBGET integrated database retrieval system