KEGG   Turneriella parva: Turpa_0968Help
Entry
Turpa_0968        CDS       T02157                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
tpx  Turneriella parva
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:tpx00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:tpx00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
986077..987618
Genome map
AA seq 513 aa AA seqDB search
MKAVATDFTRPIWESLGWEAFGVEDRVEIKSVTQDSREVKKGSAFFAYDGSKVSGKDFIW
EAFDKQAAAVFIDREYKDEIFRDARYNLHLPIFFTPDFLRAAGRTISFFFGEPTRYMACV
GVTGTNGKTTIAHSLYQALNQLGKTSMYIGTLGMEVSRHKTVTGMTTPDTVTLQSMLHQG
QKQKALYACLETSSHGLAQGRLEGINFQIGIFTNLTQDHLDYHRNMESYYRAKRRLFEYM
LFSSRKQPESAKGAVICIDDDYGRRLYLWLKSQTPSFPVISLSLRDKTADAYITDVEATF
DGYSCVLVFAQKSYFIKTRLLGRFNLMNLSSAFLALLCLGFGTEEALAAIQQVEPVPGRF
EVLRGKEQRAVIIDYAHSPDALAKVLETAQELTPARVIGLFGCGGDRDKDKRPQMAEVAS
LHSDLCILTNDNPRSEDPKNIIEDMRKGLKTARYLVISDREKAIRAGLQILGPRQVLVIA
GKGHEDYQIIGNKTLHFSDRDTALKLMGSLKIR
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtcgcaacagactttacccgtcccatttgggaatctctcggctgggaagcg
ttcggcgttgaagaccgcgtcgaaatcaagtcggtgacccaagatagccgcgaagtgaaa
aaaggctcagctttttttgcatacgacggcagcaaggtcagcggcaaagacttcatctgg
gaggccttcgacaagcaggcggcagccgtttttatcgaccgcgaatataaagacgagata
tttcgcgacgcgcgctataacctgcacttgccaatattcttcacccctgattttctgagg
gccgcaggcagaacgatttcattctttttcggcgaacccacgcgctacatggcctgtgtc
ggcgtcaccggcacaaacggcaagacaaccatcgcgcactcgctgtaccaggcgctgaac
cagctgggcaaaacctcaatgtatattggcactctgggtatggaggtttcacgccataag
actgtgacgggcatgacgacccccgacacggtgaccctgcagagtatgctgcaccagggc
cagaagcagaaggccctttatgcatgccttgaaaccagttcgcatggtttggcgcaaggg
cgactcgaaggcatcaactttcagattggtatttttacgaacctgacgcaagaccatctc
gactaccaccgcaacatggagtcgtattaccgggcgaagcgccggctctttgaatacatg
ctgttctcttcacgcaagcagcccgaatctgcgaagggtgccgtcatctgtatcgatgac
gactacgggcgccgcctgtacctttggctcaagagccaaacaccttctttcccggttatt
tcgctgagcctgcgcgacaagacagcagacgcctacatcaccgatgtcgaagcgactttc
gacggttacagctgcgtgctggtatttgcccagaagagttactttatcaaaacacgattg
ctcggtcgcttcaacctcatgaatctttcgtcagcgtttctggcattactctgcctcggc
ttcggcacagaagaagccctcgccgcaattcagcaggtcgaacctgtacccggtcgcttt
gaagtgttgcgcggcaaagagcagcgcgcggtcatcatcgactatgcacactcgcccgac
gcgcttgccaaggtgctcgagaccgcacaagaactcacgcccgcgcgtgtcatcggcctc
ttcggctgcggcggcgaccgcgacaaagacaaacgcccacagatggcagaggtcgcgagt
ctgcattcagacctgtgcattctcaccaatgacaatccgcgcagcgaagacccgaagaat
atcatcgaagatatgcgcaagggtctaaagaccgcgcgctatctggtgatctcagaccgc
gagaaggcgattcgcgctggcttacagattctcggaccaagacaggtgctggtgatcgcc
ggcaaaggccatgaggattaccagattatcggcaataagacgctgcacttttcagaccgc
gacactgcactaaagttaatgggctctttaaaaatcaggtaa

DBGET integrated database retrieval system