KEGG   Turneriella parva: Turpa_1324Help
Entry
Turpa_1324        CDS       T02157                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
tpx  Turneriella parva
Pathway
tpx00620  Pyruvate metabolism
tpx00630  Glyoxylate and dicarboxylate metabolism
tpx01100  Metabolic pathways
tpx01110  Biosynthesis of secondary metabolites
tpx01120  Microbial metabolism in diverse environments
tpx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tpx00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Turpa_1324
   00630 Glyoxylate and dicarboxylate metabolism
    Turpa_1324
Enzymes [BR:tpx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Turpa_1324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: AFM11972
UniProt: I4B3W5
Position
complement(1343383..1344975)
Genome map
AA seq 530 aa AA seqDB search
MLKLPAGVTIATDALQKTDAKFSEILTTEALEFVAKLSRQFEARRQELLAARVKRAKALE
AGEKPDFLKSTAKIRGGDWKVAPLPKDLECRRVEITGPVDRKMVINALNSGADSYMTDFE
DSNTPNWQNQINGQINLRDAIRRQIDFESGGKQYKLNQKTATLLVRPRGWHLDEKHIQID
GKRISGGIFDFGLFFFHNAKELIARGSGPYFYLPKMESHLEARLWNDVFVMAQKELGIPN
GTIRATVLIETILAAFEMDEILYELKDHSAGLNAGRWDYIFSCIKKFKNDKNFCLANRSL
VTMTSPFMRSYALLLLKTCHKRGAPAIGGMSALIPIKNDAAANEKALAGVKADKARDAGD
GYDGGWVAHPGLVDLAMQEWKKVLGTKPNQIDKQRDDVNVVAADLLNFQPEAPITEQGLR
YNINVGIHYLGSWLAGNGCVPIHNLMEDAATAEISRSQVWQWIRSAKGVLDDGRKISEDL
VRALIPDELEKVKEVTGGGPTYDQAARIFVDMSTSADFAEFLTLPLYERI
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaattacctgccggtgtgaccattgccaccgatgccctgcaaaagaccgatgca
aaattcagtgaaattctcacgacagaagcgctagagtttgtcgcgaaacttagccgccag
ttcgaagcacgccgccaagaactgctcgccgcgcgagtgaaaagagcgaaggcactcgag
gcaggtgaaaagccagattttctcaagagcaccgccaaaattcgcggcggcgactggaag
gttgcgcccctgccgaaagacctcgaatgccggcgcgtcgagatcacgggtccggttgat
cgcaaaatggtcatcaacgcgctcaactcaggcgctgacagctacatgaccgacttcgaa
gattcgaacacgcccaactggcaaaaccagatcaacggacagatcaacctgcgcgatgcg
attcgccggcaaatcgattttgaatcgggcggcaagcaatacaagctcaaccaaaagaca
gcgactctgctcgtgcgcccgcgcggctggcacctcgatgagaagcacattcagatcgac
ggcaaaagaatttcgggcggcattttcgattttggcctgttcttttttcacaacgcgaaa
gagctgatcgcgcggggcagcgggccatacttctatctgccgaaaatggagtcgcacctc
gaagcacgcctgtggaacgacgttttcgtgatggcgcagaaagaactcggcataccgaac
ggcacaattcgcgcgaccgtgctcatcgaaacaattctcgccgcgttcgagatggatgaa
attctgtacgaactcaaagaccacagcgccggcctcaatgccggcagatgggattatatt
ttttcgtgcatcaagaaattcaagaacgacaagaacttttgcctggcgaaccgttctctg
gtgacgatgacatccccctttatgcgcagctatgcgctgctgctgctcaagacctgccat
aaacgcggggcgccggcgattggcggcatgagcgcgctgataccgatcaagaacgatgcg
gcggcgaatgaaaaagcactggccggggtcaaagccgataaagcgcgagatgctggcgat
ggctatgacggcggctgggttgcgcacccgggcctcgtcgacctcgcgatgcaagaatgg
aaaaaggtattgggcacgaaacccaaccagatcgacaaacagcgtgatgatgtgaatgtt
gtggcggcagacctcttgaattttcaacccgaagcgccgatcactgaacagggccttcgg
tataatatcaacgtcggcattcactacctcggctcatggcttgcgggtaatggctgtgtg
ccgattcacaacctcatggaagacgcggcgaccgccgagatttcacgctcgcaggtctgg
cagtggattcgctctgccaagggtgtgctcgacgacggccgcaagatcagcgaagacctt
gtgcgcgcactgatacccgacgagctcgagaaggttaaagaggtaaccggcggcgggccc
acttacgaccaggcagcgcgtatcttcgtcgatatgtcgacctcggcagactttgcggag
tttctgaccctgccgctatacgaacgtatctaa

DBGET integrated database retrieval system