KEGG   Turneriella parva: Turpa_1383Help
Entry
Turpa_1383        CDS       T02157                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
tpx  Turneriella parva
Pathway
tpx00860  Porphyrin and chlorophyll metabolism
tpx01100  Metabolic pathways
tpx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tpx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Turpa_1383
Enzymes [BR:tpx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Turpa_1383
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Turpa_1383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO NAD_binding_9 Thi4 Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AFM12031
UniProt: I4B424
Position
1394263..1395621
Genome map
AA seq 452 aa AA seqDB search
MQRIAVVGAGISGLSHAYYLKKKFPQAHVALFNGQKPGGNIATEQHEGATLEPGPDSYLD
RSGLFNQLITELDIKDKLLFEDKKSAKRYILKDGYLVAAPKSPGGFITTSLLFFPEKIRI
FLAMRRKFSLWPTITLFDAARNVLGFSAAEYLASPFARGVYGSEAEDLEFSSVFPQLFGK
IVAAPRLKNALKEYMLERKNFWQGELGEVKFEKGIYCFKGGMVTWVDAFVKKLQAMGVEL
VNEKIARVQTASGGQLQLSSKSRQFDAFDHIVSTIGTADVAYVLRDFDKELAKKVAELKH
SPINVVYSGYNRKEFSYAGYGFLVPRKERASILGSIFASNVFPGRAPDDIFLTKTMISGE
SDLFKDAELASLAEESLARVMKVRAKPKWSRVFRHTPGIPRYAPGYGEWKRDVMALKEKH
PNLHLAGWAFSGIGLADQLESGYLHARSIATK
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgaatcgctgtggtgggtgccggtatctcgggtctcagccatgcctattacctc
aagaagaagtttccacaggcgcacgtggcactcttcaacgggcaaaaaccgggaggcaat
atcgccaccgagcagcacgagggtgcgacgctcgagccaggccctgattcgtatctcgat
cgcagcgggctttttaaccagctgataaccgagctcgatattaaagacaagttgcttttc
gaagacaagaagagtgcgaagcgttacattcttaaagacggttatttggtagcagctccg
aaatcaccggggggattcataacgacatcgttattgttctttcctgaaaaaatccgcatt
tttctggcgatgcgccgcaaattctccctgtggccaacgattacgcttttcgatgctgcc
cgcaatgtcctgggctttagtgcagcggaataccttgcctcaccttttgcccgcggcgtt
tatggcagcgaagcagaagacctggagttttcatcggtgtttccgcagctctttggtaag
atagtggcggcgccgcgcctcaagaatgcactcaaagaatatatgctcgagcgcaagaat
ttctggcagggcgaactcggtgaggttaagttcgaaaagggtatctactgctttaagggc
ggcatggtcacctgggttgacgccttcgtcaaaaagctgcaggctatgggtgtagagtta
gtcaacgagaagatagcgcgcgtgcagactgcctcagggggccagctgcagctcagctct
aaatcccgccagtttgatgcatttgaccacatcgtctcgacgattggtacagccgatgtt
gcctatgtgctcagagacttcgacaaagaactggcgaaaaaggtagccgagctcaagcat
tcgccgatcaatgtcgtctattcgggctacaatcgcaaagagttctcatacgctggttat
ggctttctcgtgccgcgcaaagaacgggcttcgattctaggttcgatattcgcaagcaat
gtttttcccgggcgcgcacccgacgatatttttctcaccaagacgatgatctcgggcgag
agcgatctcttcaaagatgcggagttggcatctttggctgaagagtctctggcgcgtgtc
atgaaggttcgtgccaaaccgaaatggagccgggttttcaggcatacacccggcattccg
cgttatgccccgggttatggcgagtggaaacgcgacgtcatggcgctaaaagaaaaacac
ccgaacctgcacctcgcaggctgggcgttttcgggaattggtttggcagaccagctggaa
tctggctacctgcacgcgaggtcaatcgccacaaaatga

DBGET integrated database retrieval system