KEGG   Turneriella parva: Turpa_1707Help
Entry
Turpa_1707        CDS       T02157                                 

Definition
(RefSeq) aldose 1-epimerase (EC:5.1.3.3)
  KO
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
tpx  Turneriella parva
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tpx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Turpa_1707
   00052 Galactose metabolism
    Turpa_1707
Enzymes [BR:tpx01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Turpa_1707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1713470..1714519)
Genome map
AA seq 349 aa AA seqDB search
MCRFLNVVGCLANFLNNKFARFTEYGARLVSLSVPDRTGNLVDVVTGYDSDEDYRKGARF
FGANVGPFANRIANARFAIDGTEYHFTPNGNGHLLHSGEQGLDSVLWNWARGERSRTTAA
TDGIAFTYHSPDGEFGFPGPVDYSIHYRLLPGPTLRIEYTAVPQKATHLNIAHHSYFNLA
GHDAGSIDDHLVQINAAHYLEVDADSIPTGKLLPVEKTPLDLRNPARIGDRLKADFLPLR
TCGGFDQCFVVDTSRPPTAGLYFAARVVAPQTGIAMEIHSSYPALQFYTANHDLPPMPGK
GGAVYRRHGSFCLEPQFFPNSPNIAHFPSTLVRPGETYRQIAEFRFSVF
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtgccgctttctgaacgtggttgggtgtttggcgaatttcttaaataacaaatttgcg
cgcttcaccgaatacggcgcgcgcctcgtctcgctctcggtacccgaccgcacgggcaac
ctcgtcgacgttgtgacgggctatgacagcgacgaagactaccgcaagggtgcgcgcttc
ttcggcgcgaacgtcggcccgtttgctaaccgcatcgccaatgcgcgctttgccatcgac
ggcaccgaataccacttcacacccaacggcaacggccaccttttgcacagcggcgagcag
ggcctcgactcagtgctatggaattgggctcgtggtgagcgcagtcgaaccacagccgcg
accgacggaattgccttcacctaccacagtcccgacggcgaatttggttttcccggcccg
gtcgactatagcattcactacagacttttgcccggcccgacgctgcgcatcgaatacacg
gccgtgccgcagaaggcgacgcacctcaacatcgcgcaccactcgtacttcaatcttgca
ggccacgacgccggcagcatcgacgaccatctcgtgcagatcaacgcggcacattacctc
gaagtcgacgctgattcgataccgacgggaaaacttttgcccgtcgagaagactccgctc
gacttacgaaatcccgcacgtattggcgataggcttaaggcggattttctgccgttacga
acctgcggcggttttgatcaatgcttcgtcgtcgatacgtcgcggccgccgactgcgggc
ctctatttcgccgcgcgcgtggtggcgccccagaccggtatagctatggaaatccatagc
agctacccggcgctgcagttctacaccgcgaaccacgacctgccgccgatgccgggcaaa
gggggcgcggtctatcgaaggcacggttcgttctgcctcgagccgcagttttttcccaac
tcgccgaatatcgcgcattttccttcgacgttggtgcgccccggtgaaacctaccggcag
atagcggagttcaggttttccgtcttttag

DBGET integrated database retrieval system