KEGG   Turneriella parva: Turpa_1952Help
Entry
Turpa_1952        CDS       T02157                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
Organism
tpx  Turneriella parva
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AFM12599
UniProt: I4B5P2
Position
1989491..1990261
Genome map
AA seq 256 aa AA seqDB search
MHVFITGAATGIGEATIDAVFEKVPSAGFTIADKNQQALQAVCEKLTRRGVHNHGIACDL
TELDAIPDIVKRAREQMGEIELLINNAGVMLVEDFATMSWQKAMLTINLNLLAPARLMKE
VLPSMLERDKGGVINIASMAGKTLMHGCSWYGASKAGIGQISEITGMEVEGSNVHILTVY
PGPIDTNLAAGARANLEENFAARVMPVGDRETLARKMVKAFFDKQDVLAYPEIYDTARHF
HTLSAWFARRFSPRTR
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtttttattaccggcgccgcaacgggtattggcgaagcgacaattgacgcggtt
ttcgaaaaagtgccttctgccggcttcacaattgctgacaagaaccaacaggcactgcag
gccgtttgcgaaaagctgacgcggcgcggggtgcataaccacggcatcgcctgcgatctc
accgaactcgacgcaattccggacattgtgaaaagggcgcgggagcagatgggcgagatt
gagctgctcatcaacaatgccggtgtgatgctcgtcgaagacttcgcgaccatgagctgg
caaaaggcgatgctgacgattaacctcaatctgctcgcacccgcgcgcctcatgaaagag
gtgctgccgtcgatgctcgaacgcgacaaagggggagttatcaatatcgccagtatggca
ggcaaaacgctgatgcacggctgttcatggtatggcgcttcaaaagcgggcatcggacaa
atttctgaaatcacgggtatggaagttgaaggttcgaatgtgcatattctgactgtttat
ccggggccaattgacacgaatctcgcagcaggggcgcgggcgaatctcgaagaaaatttc
gctgcgcgcgtcatgccggtgggtgaccgtgagactctcgccagaaaaatggtgaaggca
ttctttgataaacaagatgtgcttgcgtaccccgaaatatacgacacggcgcgtcacttt
cacactctttcggcctggtttgcgcgcaggttctcgccgcgtacgcgctga

DBGET integrated database retrieval system