KEGG   Turneriella parva: Turpa_1958Help
Entry
Turpa_1958        CDS       T02157                                 

Definition
(GenBank) metallo-beta-lactamase
  KO
K00784  ribonuclease Z [EC:3.1.26.11]
Organism
tpx  Turneriella parva
Brite
Enzymes [BR:tpx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.11  tRNase Z
     Turpa_1958
Transfer RNA biogenesis [BR:tpx03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factors
    Turpa_1958
 Prokaryotic Type
    Turpa_1958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lactamase_B_2 Lactamase_B
Motif
Other DBs
NCBI-ProteinID: AFM12605
UniProt: I4B5P8
Position
complement(1994560..1995393)
Genome map
AA seq 277 aa AA seqDB search
MIDFRHKDIAVNAIGRGGIETCYILPAFQLAFDTGRCPDGLIDMPRVFLTHGHLDHSAGL
PYYISQRSLRHLPPPEIYCPAEIVAPLREILHLWQKIEGFEYPVALKGLSPGDEIPVRKD
LYVRALASSHRVPCRGYALVRKTRKLKDEYLTVNGREIKRMKDRGEAIFEDRDIPIFAFS
GDTTIEFLQDNQAAREATVLFIECTYIDDKRPVARAREWGHIHLDEIIAHAHLFKNEKIV
LTHFSKRYNRRFILQVLNKKLQDHDLLSRIFVLAHDD
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgattttcgccacaaagatattgccgtcaacgcgatcggtcgcggtggcattgaa
acctgttatattttgcccgcgtttcagctcgcctttgacacaggcagatgccccgacggg
ctaatcgacatgccgcgggtctttctcacgcacggtcacctcgatcattctgcgggtctg
ccttattacatcagccagcgcagcctcaggcacctgccgccgccagagatttattgcccc
gccgagatcgttgcgccgctccgtgaaattctacacctctggcaaaaaatcgaagggttt
gaatatcccgtggcgctcaagggtctctcaccaggtgatgagataccggtgcgcaaagat
ctttatgtacgcgctctcgcctcaagccaccgggtgccctgccgcggttacgcgctggtg
cgcaaaacgagaaaactcaaagacgaatacctcacagtaaacggacgtgagatcaagcgc
atgaaagaccgcggtgaagcaatttttgaagaccgtgatattccgatcttcgctttttca
ggcgacacgaccatcgagtttctgcaagacaatcaggctgcgcgcgaggcgaccgtgctt
ttcattgagtgcacgtatattgacgacaagcgcccggtggcgcgcgcacgcgaatggggc
cacatacatctcgatgagattatcgcgcacgcgcatctcttcaaaaacgaaaagattgta
ctcacccatttttcgaaacgctataaccgccgctttatactgcaggttttgaataagaaa
ctgcaagaccacgacctgctttcacgcatctttgtactcgcgcatgacgactga

DBGET integrated database retrieval system